Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Glass Ball Ornaments Hanging Globe Micro Landscape Santa Claus Snowman Reindeer Transparent Festive Decor
Christmas Glass Ball Ornaments Hanging Globe Micro Landscape Santa Claus Snowman Reindeer Transparent Festive Decor
like
Find Similar
Festive clear glass Christmas ball ornament featuring a white reindeer and red mushrooms - Elk Style
Transparent glass Christmas ball ornament featuring a snowman and tree, size 9x9x10.5cm - Christmas Tree
Christmas glass ball ornament featuring Santa Claus and tree inside with artificial snow - Santa Claus
Christmas glass ball ornament with snowman and blue figure in snowy miniature scene - Snowman
Christmas Glass Ball Ornaments Hanging Globe Micro Landscape Santa Claus Snowman Reindeer Transparent Festive Decor
-5%
$5.47
No MOQ
 · 
29 views
Kids Christmas Bow Hair Clips Girls Large Handmade Grosgrain Ribbon Snowman Santa Claus Snowflake Holiday Party Hair Accessories
Kids Christmas Bow Hair Clips Girls Large Handmade Grosgrain Ribbon Snowman Santa Claus Snowflake Holiday Party Hair Accessories
like
Find Similar
Green Christmas bow hair clip featuring a festive felt snowman head for girls - Style 12 (Snowman Patchwork)
Christmas bow hair clip for girls featuring a green ribbon and a cute plush snowman head - Style 11 (Plush Snowman)
Christmas bow hair clip for girls with green ribbon, snowman mesh and golden greeting - Style 7 (Printed Mesh Snowman)
Green and red Christmas bow hair clip with white snowflake pattern and ribbon texture - Style 4 (Snowflake Print)
+7
Kids Christmas Bow Hair Clips Girls Large Handmade Grosgrain Ribbon Snowman Santa Claus Snowflake Holiday Party Hair Accessories
$0.74
No MOQ
 · 
43 views
LED Luminous Christmas Wooden House Hanging Ornaments DIY Laser Cut Wood Cabin Santa Snowman Reindeer Holiday Decor
LED Luminous Christmas Wooden House Hanging Ornaments DIY Laser Cut Wood Cabin Santa Snowman Reindeer Holiday Decor
like
Find Similar
Wooden Christmas cabin ornament with Santa Claus and LED light, hanging DIY holiday decor - Single Roof Santa Style
LED wooden Christmas house pendant with snowman and star cutouts for tree decoration - Single Roof Snowman Style
Luminous wooden Christmas house pendant with laser-cut star and reindeer patterns - Single Roof Elk Style
Wooden Christmas cabin ornament with skiing snowman pattern and warm LED light - Double Roof Snowman Style
+2
LED Luminous Christmas Wooden House Hanging Ornaments DIY Laser Cut Wood Cabin Santa Snowman Reindeer Holiday Decor
$1.38-1.56
Mix MOQ : 2
Tiered Tray Decor Set Wooden Winter Snowman Signs Christmas Tabletop Decoration Farmhouse Style Holiday Home Ornaments
Tiered Tray Decor Set Wooden Winter Snowman Signs Christmas Tabletop Decoration Farmhouse Style Holiday Home Ornaments
like
Find Similar
Size chart for 6-piece winter tiered tray set showing dimensions of wooden snowmen signs - Wooden Winter Tiered Tray Decor Set Grey White
Tiered Tray Decor Set Wooden Winter Snowman Signs Christmas Tabletop Decoration Farmhouse Style Holiday Home Ornaments
-4%
$2.74
No MOQ
 · 
20 views
Christmas Family House Resin Hanging Ornament Red Brick House Snowman DIY Style Holiday Tree Pendant Festive Home Decor
Christmas Family House Resin Hanging Ornament Red Brick House Snowman DIY Style Holiday Tree Pendant Festive Home Decor
like
Find Similar
Christmas snowman house hanging ornament with red brick design and snow roof for tree decor - 2 Person Family House Snowman Ornament
Detailed resin Christmas house ornament featuring snowy roof and snowman figures in windows - 3 Person Family House Snowman Ornament
Customized 4-person family Christmas house ornament with snow roof and festive wreath - 4 Person Family House Snowman Ornament
Customized 5-person family Christmas house resin ornament with snowman and red sequins - 5 Person Family House Snowman Ornament
+1
NewChristmas Family House Resin Hanging Ornament Red Brick House Snowman DIY Style Holiday Tree Pendant Festive Home Decor
$2.59
Mix MOQ : 2
Christmas Chair Covers 3D Cartoon Santa Snowman Reindeer Pattern Linen Sequin Fabric Dining Room Seat Back Protectors For Festive Holiday Home Restaurant Decor
Christmas Chair Covers 3D Cartoon Santa Snowman Reindeer Pattern Linen Sequin Fabric Dining Room Seat Back Protectors For Festive Holiday Home Restaurant Decor
like
Find Similar
Close-up of a 3D Santa knitted chair cover with hanging star and heart festive tags - Red 3D Santa
Detail of knitted Christmas chair cover featuring a 3D snowman with scarf and snowflakes - Red 3D Snowman
Detail of Christmas chair cover with 3D reindeer design on wooden dining chair - Red 3D Reindeer
Detailed close-up of a pink sequin Santa chair cover with faux fur and checkered patterns - Pink Sequin Santa
+18
Christmas Chair Covers 3D Cartoon Santa Snowman Reindeer Pattern Linen Sequin Fabric Dining Room Seat Back Protectors For Festive Holiday Home Restaurant Decor
$1.30-5.33
No MOQ
Christmas Ornaments Wool Felt Pendants Handmade Tree Decorations Santa Snowman Reindeer DIY Craft Accessories Festive Party
Christmas Ornaments Wool Felt Pendants Handmade Tree Decorations Santa Snowman Reindeer DIY Craft Accessories Festive Party
like
Find Similar
Five handmade wool felt reindeer dolls with antlers for Christmas tree decor - Antler Doll Coffee 4pcs/pack
Red Christmas wool felt gift box charms with white dots and green bow for DIY crafts - Gift Box Red 4pcs/pack
Green felt Christmas gift box patches with red bows for DIY bouquet packaging and crafts - Gift Box Green 4pcs/pack
Three-piece set of handmade Christmas reindeer plush brooches with gold glitter antlers - Antler Head Coffee 3pcs/pack
+18
Christmas Ornaments Wool Felt Pendants Handmade Tree Decorations Santa Snowman Reindeer DIY Craft Accessories Festive Party
-4%
$4.11-4.38
Mix MOQ : 2
Free Shipping
Decorative Christmas Stockings Knitted Felt Holiday Ornaments With 3D Santa Snowman Reindeer For Fireplace Hanging Gift Bags
Decorative Christmas Stockings Knitted Felt Holiday Ornaments With 3D Santa Snowman Reindeer For Fireplace Hanging Gift Bags
like
Find Similar
Plaid red and black knit Christmas stocking with white faux fur trim and ribbon, 14x18cm - Black Red White Plaid Stocking / 14*18cm
Red and grey Christmas stocking with plush cuff and diamond pattern, size 14x18cm - Red Black Grey Argyle Stocking / 14*18cm
Red reindeer knit Christmas stocking with white faux fur trim and geometric patterns - Red Reindeer Knitted Stocking / 14*18cm
Red and white knitted Christmas stocking featuring a 3D Santa Claus and snowflake pattern - 3D Santa Claus Snowflake Style / 25*43cm
+18
Decorative Christmas Stockings Knitted Felt Holiday Ornaments With 3D Santa Snowman Reindeer For Fireplace Hanging Gift Bags
$1.38-10.09
Mix MOQ : 2
 · 
10 sold recently
Free Shipping
Christmas Printed Tablecloth Polyester Snowman Snowflake Pattern Rectangular Festive Party Table Cover For Dining Decoration
Christmas Printed Tablecloth Polyester Snowman Snowflake Pattern Rectangular Festive Party Table Cover For Dining Decoration
like
Find Similar
Festive red Christmas tablecloth set with snowman and tree patterns for party decor - Snowman / 140x100
Christmas polyester tablecloth with festive tree patterns in a cozy dining room setting - Christmas Tree / 140x100
Christmas theme waterproof tablecloth set with Santa and reindeer patterns for party decor - Blue Christmas / 140x100
Christmas tablecloth with Santa Claus and stars on dark blue background for dining table - Blue Santa / 140x100
+45
Christmas Printed Tablecloth Polyester Snowman Snowflake Pattern Rectangular Festive Party Table Cover For Dining Decoration
$4.29-9.19
No MOQ
Christmas Gnome Plush Doll Telescopic Long Leg Faceless Tomte Nordic Standing Snowman Ornament Festive Fabric Iron Decoration
Christmas Gnome Plush Doll Telescopic Long Leg Faceless Tomte Nordic Standing Snowman Ornament Festive Fabric Iron Decoration
like
Find Similar
Grey knitted hat Christmas gnome doll with telescopic legs and weighted sand base - Gray Hat Gnome Style (A410-9) / 30cm
Telescopic Christmas Gnome doll adjusts from 80cm to 130cm height in red and grey - Telescopic Long Leg Gnome Style (A410-1) / 130cm
Christmas gnome doll with adjustable telescopic legs from 80cm to 110cm in red and grey - Male Telescopic Gnome (A410-2 Male) / 110cm
Telescopic Christmas elf doll for women with adjustable height 80-110cm in red and grey - Female Telescopic Gnome (A410-2 Female) / 110cm
+8
Christmas Gnome Plush Doll Telescopic Long Leg Faceless Tomte Nordic Standing Snowman Ornament Festive Fabric Iron Decoration
-5%
$4.33-20.75
No MOQ
 · 
15 views
Christmas Snow Globe Lantern LED Lighted Spinning Glitter Water Lamp Vintage Santa Claus Snowman Scene Desktop Decoration
Christmas Snow Globe Lantern LED Lighted Spinning Glitter Water Lamp Vintage Santa Claus Snowman Scene Desktop Decoration
like
Find Similar
Retro red Christmas snow globe lantern with Santa Claus sleigh scene and LED lighting - 30cm / Large Red Santa Sleigh
Vintage bronze musical snow globe lantern with snowman scene, 25cm height Christmas decor - 25cm / Small Bronze Hexagon Snowman & Tree
Antique bronze Christmas snow globe lantern with Christmas tree and 25cm height label - 25cm / Small Bronze Hexagon Gifts & Tree
25cm vintage bronze Christmas lantern with Santa scene and warm LED snow lighting - 25cm / Small Bronze Hexagon Santa & Girl
+8
Christmas Snow Globe Lantern LED Lighted Spinning Glitter Water Lamp Vintage Santa Claus Snowman Scene Desktop Decoration
$28.24-31.12
No MOQ
 · 
12 views
Christmas Hair Clips Resin Cartoon Santa Snowman Tree Gingerbread Man Metal BB Clips For Girls Holiday Accessories
Christmas Hair Clips Resin Cartoon Santa Snowman Tree Gingerbread Man Metal BB Clips For Girls Holiday Accessories
like
Find Similar
Close-up of a festive red hair clip featuring a cute 3D Santa Claus character decoration - Red Santa Claus Hair Clip
Detail of red Christmas tree hair clip with resin decorations and yellow star on white plate - Red Christmas Tree Hair Clip
Close-up of a festive red metal hair clip featuring a cute white resin snowman detail - Red Snowman Hair Clip
Detailed shot of a red Christmas hair clip with a yellow smiling star on a plate - Red Christmas Star Hair Clip
+8
Christmas Hair Clips Resin Cartoon Santa Snowman Tree Gingerbread Man Metal BB Clips For Girls Holiday Accessories
$0.14
Mix MOQ : 2
Christmas Drawstring Gift Bags 3D Santa Snowman Reindeer Design Burlap Flannel Knitted Fabric Holiday Party Candy Packaging
Christmas Drawstring Gift Bags 3D Santa Snowman Reindeer Design Burlap Flannel Knitted Fabric Holiday Party Candy Packaging
like
Find Similar
Detail of Christmas snowman plush figure with red polka dot hat on natural wood base - Red and White Snowman
Knitted Santa Claus doll figurine with snowflake decor on a rustic wooden base - Red and White Santa
Red Christmas drawstring gift bag with a 3D plush polar bear wearing a festive hat - Red Flannel Bear
Christmas gift drawstring bags with 3D Santa, Reindeer and Snowman plush doll figures - Red Flannel Reindeer
+29
Christmas Drawstring Gift Bags 3D Santa Snowman Reindeer Design Burlap Flannel Knitted Fabric Holiday Party Candy Packaging
-5%
$0.71-2.33
Mix MOQ : 2
Christmas Cushion Cover Plush Square Santa Claus Snowman Nutcracker Print Red Gold Holiday Home Sofa Decor
Christmas Cushion Cover Plush Square Santa Claus Snowman Nutcracker Print Red Gold Holiday Home Sofa Decor
like
Find Similar
Christmas peach skin pillowcase with Santa Claus and Merry Christmas print - Style 16 / 18x18 Inch
Christmas pillowcase featuring a cute snowman design with vibrant red festive patterns - Style 8 / 18x18 Inch
Detail of Santa Claus snow globe print on peach skin pillowcase for Christmas decoration - Style 11 / 18x18 Inch
Modern Christmas pillowcase featuring Santa Claus with red accents and Merry Christmas text - Style 15 / 18x18 Inch
+12
Christmas Cushion Cover Plush Square Santa Claus Snowman Nutcracker Print Red Gold Holiday Home Sofa Decor
$1.27
Mix MOQ : 2
 · 
20 sold recently
Enamel Alloy Christmas Earrings Santa Snowman Bell Tree Candy Cane Shape Holiday Party Fashion Accessory For Women
Enamel Alloy Christmas Earrings Santa Snowman Bell Tree Candy Cane Shape Holiday Party Fashion Accessory For Women
like
Find Similar
Sparkly Christmas stocking stud earrings in red and green with festive glitter finish - Glitter Christmas Sock Stud Earrings
Detail of Christmas stud earrings set featuring Santa, gift box and stocking designs - Santa/Gift/Stocking Set
Christmas stud earring set featuring Santa gnome, red house and green glitter xmas tree - Snow House/Gnome/Tree Set
Detail view of 6 pairs of Christmas stud earrings including Santa and holiday trees - Full Christmas 6-Pair Set
+6
Enamel Alloy Christmas Earrings Santa Snowman Bell Tree Candy Cane Shape Holiday Party Fashion Accessory For Women
$0.50-1.28
No MOQ
 · 
10 views
Free Shipping
Christmas Decoration Apron Cartoon Santa Claus Reindeer Snowman Pattern Holiday Cooking Accessory Polyester Fabric
Christmas Decoration Apron Cartoon Santa Claus Reindeer Snowman Pattern Holiday Cooking Accessory Polyester Fabric
like
Find Similar
Christmas apron with festive Santa outfit print and holiday decorative elements - 01 Female Black Belt Style
Christmas Santa's Little Helper apron with festive green and white elf leg patterns - 02 Christmas Elf
Detailed view of red Christmas apron with reindeer pattern and Merry Christmas text - 03 Reindeer Head
Blue Christmas apron with cute cartoon snowman pattern for holiday festive cooking decor - 05 Christmas Snowman
+3
Christmas Decoration Apron Cartoon Santa Claus Reindeer Snowman Pattern Holiday Cooking Accessory Polyester Fabric
$1.64
No MOQ
 · 
109 sold recently
Teardrop Dangle Earrings PU Leather Copper Hook Christmas Snowman Reindeer Nurse Teacher Theme Jewelry Gift
Teardrop Dangle Earrings PU Leather Copper Hook Christmas Snowman Reindeer Nurse Teacher Theme Jewelry Gift
like
Find Similar
Detail of pencil-shaped PU leather earrings with red plaid and teach inscription - Pencil Teacher Style
Close-up of teardrop faux leather earrings featuring reindeer and snowman holiday print - Christmas Reindeer Snowman Style
Faux leather teardrop earrings featuring a reindeer nurse with medical stethoscope - Nurse Reindeer Style
Detail of teardrop leather earrings with Teach Love Inspire print and truck pattern - Love Truck Style
+6
Teardrop Dangle Earrings PU Leather Copper Hook Christmas Snowman Reindeer Nurse Teacher Theme Jewelry Gift
$0.76
Mix MOQ : 2
 · 
55 sold recently
Free Shipping
Pink Christmas Paper Gift Bags With Handles For Holiday Party Favors Reindeer Santa Snowman Designs
Pink Christmas Paper Gift Bags With Handles For Holiday Party Favors Reindeer Santa Snowman Designs
like
Find Similar
Pink striped Christmas gift bag featuring vintage Santa Claus and white rope handles - Vintage Santa Claus
Pink Christmas paper gift bag with golden Merry Christmas text and festive tree designs - Pink Christmas Tree
Pink Christmas kraft paper gift bag with snowman and snow-covered house illustration - Snowy Snowman
Pink and gold chevron Christmas gift bag with HO HO HO text and white rope handles - Pink Gold Chevron
+2
Pink Christmas Paper Gift Bags With Handles For Holiday Party Favors Reindeer Santa Snowman Designs
$0.17
Mix MOQ : 24
 · 
29 views
Christmas Throw Pillow Cover Linen Watercolor Forest Green Snowman Illustration For Sofa Couch Holiday Home Decor
Christmas Throw Pillow Cover Linen Watercolor Forest Green Snowman Illustration For Sofa Couch Holiday Home Decor
like
Find Similar
Christmas cushion cover with green linen and watercolor winter snow town scene decoration - YMD15-1 (Christmas Market Snow)
Christmas cushion cover with green stocking print on linen for festive sofa decor - YMD15-2 (Fireplace Stocking)
Green linen Christmas pillow case with watercolor winter suitcase and snowy pine tree - YMD15-3 (Vintage Suitcase)
Christmas watercolor cushion cover featuring candles, pinecones, and gift boxes on linen - YMD15-4 (Candle Gift Box)
+32
Christmas Throw Pillow Cover Linen Watercolor Forest Green Snowman Illustration For Sofa Couch Holiday Home Decor
$1.30
Mix MOQ : 2
Vintage Church Christmas Lantern LED Night Light Retro Bronze Plastic Snow Globe Glitter Santa Snowman Tabletop Decor
Vintage Church Christmas Lantern LED Night Light Retro Bronze Plastic Snow Globe Glitter Santa Snowman Tabletop Decor
like
Find Similar
Vintage bronze Christmas lantern with LED light and snowman miniature in church design - Water-filled Snowman
Retro church style Christmas lantern with internal angel and LED sparkling lights - Church Water Filled Angel
Bronze retro church-shaped Christmas LED lantern with miniature tree and snow effect - Church Water Filled Christmas Tree
Vintage bronze Christmas lantern with Santa Claus figurine and warm LED lighting decoration - Church Water Filled Santa Claus
+1
Vintage Church Christmas Lantern LED Night Light Retro Bronze Plastic Snow Globe Glitter Santa Snowman Tabletop Decor
$3.17-3.46
Mix MOQ : 2
 · 
10 views
Christmas Enamel Brooch Pin Alloy Drip Oil Cartoon Santa Claus Elk Snowman Festive Holiday Accessory For Clothes Bags
Christmas Enamel Brooch Pin Alloy Drip Oil Cartoon Santa Claus Elk Snowman Festive Holiday Accessory For Clothes Bags
like
Find Similar
Close-up of cute cartoon reindeer brooch with brown enamel finish and golden metal edges - Elk
Detail of a snowman enamel brooch with red scarf and black hat for Christmas decor - Snowman
Close-up of a cute snowflake enamel pin with a cartoon face and golden metal edges - Snowflake
Detailed close-up of a Christmas gift box enamel pin with red and green festive colors - Gift Box
+6
Christmas Enamel Brooch Pin Alloy Drip Oil Cartoon Santa Claus Elk Snowman Festive Holiday Accessory For Clothes Bags
$0.45
Mix MOQ : 2
 · 
65 sold recently
Christmas Jewelry Set Zinc Alloy Enamel Pendant Necklace And Hook Earrings Holiday Party Cartoon Santa Snowman Theme For Women
Christmas Jewelry Set Zinc Alloy Enamel Pendant Necklace And Hook Earrings Holiday Party Cartoon Santa Snowman Theme For Women
like
Find Similar
Detailed close-up of gold Christmas stocking jewelry set with red enamel and small crystal - Christmas Sock
Detailed view of festive golden necklace and earrings set with cute snowman pendant - Snowman with Green Scarf
Detail view of festive reindeer pendant necklace and earrings set with gold finish - Elk
Detail of Christmas tree necklace and earrings set with green enamel and gold finish - Christmas Tree Potted
+6
Christmas Jewelry Set Zinc Alloy Enamel Pendant Necklace And Hook Earrings Holiday Party Cartoon Santa Snowman Theme For Women
$1.21-1.36
Mix MOQ : 2
 · 
34 sold recently
Miniature Christmas Figurines Resin Masked Santa Claus Snowman Reindeer Micro Landscape Desktop Holiday Decorations
Miniature Christmas Figurines Resin Masked Santa Claus Snowman Reindeer Micro Landscape Desktop Holiday Decorations
like
Find Similar
Miniature green Christmas gift box figurine with red bow for micro landscape decor - Green Gift Box
Miniature wooden Merry Christmas sign with snow detail for festive holiday landscape - Merry Christmas Banner Sign
Miniature green Christmas tree figurine with red bow and gold ornaments for micro landscape - Christmas Tree
Miniature Christmas snowman ornament with black hat, striped scarf and blue face mask - Snowman with Mask
+6
Miniature Christmas Figurines Resin Masked Santa Claus Snowman Reindeer Micro Landscape Desktop Holiday Decorations
-9%
$0.10-2.29
No MOQ
 · 
11 views
Christmas Pendant Necklace Alloy Enamel Santa Claus Tree Snowman Wreath Holiday Jewelry Cartoon Cute For Women Girls
Christmas Pendant Necklace Alloy Enamel Santa Claus Tree Snowman Wreath Holiday Jewelry Cartoon Cute For Women Girls
like
Find Similar
Minimalist alloy crescent moon charm with a red Christmas hat in a golden finish - Moon with Santa Hat / EAR0010/Gold White Red
Christmas tree alloy pendant with green enamel, gold edges, and a small bell detail - Christmas Tree Style 2 / EAR0015/Green Gold with Rhinestone
Christmas candy cane pendant in red and white stripes with green holly leaves on beige fabric - Candy Cane / EAR0018/Red White Green Gold
Christmas wreath pendant with red and green enamel in gold finish for jewelry making - Christmas Wreath / EAR0011/Gold Red Green
+6
Christmas Pendant Necklace Alloy Enamel Santa Claus Tree Snowman Wreath Holiday Jewelry Cartoon Cute For Women Girls
-6%
$0.10-0.15
No MOQ
 · 
120 sold recently
Free Shipping
Polyester Christmas Wall Tapestry Festive Snowman Santa Patterns Vibrant Holiday Decor Party Backdrop Hanging Blanket
Polyester Christmas Wall Tapestry Festive Snowman Santa Patterns Vibrant Holiday Decor Party Backdrop Hanging Blanket
like
Find Similar
Merry Christmas wall tapestry featuring a red Santa sleigh and snowman decoration - Peach Skin / Red Warm Santa And Snowman Style (2) / Medium (150x100)
Detail of Christmas tapestry with Santa, reindeer and snowman over a gray sofa - Peach Skin / Q-Style Blue Starry Santa And Snowman Style (4) / Medium (150x100)
Detail of Christmas wall tapestry showing Santa and gift train above a grey sofa - Peach Skin / Fairy Tale Blue Night Santa And Gift Train Style (6) / Medium (150x100)
Merry Christmas snowman tapestry with gift boxes and ornaments on a snowy background - Peach Skin / Ice Blue Snow Snowman And Gift Ball Style (1) / Medium (150x100)
+176
Polyester Christmas Wall Tapestry Festive Snowman Santa Patterns Vibrant Holiday Decor Party Backdrop Hanging Blanket
-5%
$2.46-9.86
No MOQ
Free Shipping
Christmas Stud Earrings Resin Cartoon Santa Claus Snowman Reindeer Tree Bell Glove Gift Box Cute Festive Jewelry For Women
Christmas Stud Earrings Resin Cartoon Santa Claus Snowman Reindeer Tree Bell Glove Gift Box Cute Festive Jewelry For Women
like
Find Similar
Festive Christmas bell earrings with red bow and green body on a grey display mat - Bell
Detail of Christmas tree stud earrings with festive ornaments on a grey velvet display - Christmas Tree
Macro detail of 3D green Christmas gift box stud earrings with red ribbon on grey base - Gift Box
Macro detail of Christmas red glove stud earrings with white cuffs and snowflake pattern - Gloves
+3
Christmas Stud Earrings Resin Cartoon Santa Claus Snowman Reindeer Tree Bell Glove Gift Box Cute Festive Jewelry For Women
$0.60
Mix MOQ : 3
 · 
147 sold recently
Free Shipping
Christmas Pet Bib Scarf Handmade Crochet Knitted Holiday Costume Accessories For Cats Small Dogs Santa Snowman Reindeer
Christmas Pet Bib Scarf Handmade Crochet Knitted Holiday Costume Accessories For Cats Small Dogs Santa Snowman Reindeer
like
Find Similar
Detail of handmade crochet pet bib with Christmas snowman design and red bow decoration - One Size / Snowman
Handmade crochet Christmas pet bib with Santa Claus design in festive red and white - One Size / Santa Claus (Red and White)
Festive red and green crochet pet bib with a 3D plush reindeer for Christmas holiday - One Size / Christmas Reindeer Blue
Detail of red crochet pet Christmas bib with snowflake pendant and white lace trim - One Size / Christmas Candy
+17
Christmas Pet Bib Scarf Handmade Crochet Knitted Holiday Costume Accessories For Cats Small Dogs Santa Snowman Reindeer
$1.70
No MOQ
Free Shipping
Christmas Magnetic Reflective Stickers Cartoon Santa Reindeer Snowman Bulb Decor For Car Fridge Garage Door Holiday Ornament
Christmas Magnetic Reflective Stickers Cartoon Santa Reindeer Snowman Bulb Decor For Car Fridge Garage Door Holiday Ornament
like
Find Similar
Detailed size chart for reindeer, Santa, and bells magnetic Christmas car decals - RFM003: Reindeer/Santa/Bells Set
Detailed size view of reflective Christmas Santa, reindeer, and Merry Christmas car stickers - RFM006: Merry Christmas Text/Santa/Reindeer
Detailed dimensions of seven magnetic Christmas gnome stickers for festive decor - RFM007: Christmas Gnome 7-Piece Set
Detailed size specifications for Christmas reflective reindeer and snowman magnets - RFM004: Reindeer/Snowman/Candy Cane Stickers
+17
Christmas Magnetic Reflective Stickers Cartoon Santa Reindeer Snowman Bulb Decor For Car Fridge Garage Door Holiday Ornament
-5%
$1.64-10.13
No MOQ
Free Shipping
Christmas Keychain Alloy Enamel Santa Claus Snowman Christmas Tree Bag Pendant With Faux Artificial Pearl Rhinestone Decoration
Christmas Keychain Alloy Enamel Santa Claus Snowman Christmas Tree Bag Pendant With Faux Artificial Pearl Rhinestone Decoration
like
Find Similar
Detailed view of enamel snowman keychain with faux pearl and holiday decorations - Snowman with Broom
Cartoon Santa Claus metal keychain with golden ring, red enamel charm and white pearl - Large Head Santa Claus
Detailed size specifications for cartoon Santa Claus metal keychain with faux pearl charm - Santa Claus
Detail of Santa Claus keychain with red enamel finish and white pearl pendant decor - Smiling Santa Claus
+10
Christmas Keychain Alloy Enamel Santa Claus Snowman Christmas Tree Bag Pendant With Faux Artificial Pearl Rhinestone Decoration
-13%
$0.57
No MOQ
 · 
11 views
Free Shipping
Christmas Beaded Ballpoint Pen Silicone Cartoon Santa Snowman Snowflake Decorative Beads Writing Office Stationery Holiday Gift
Christmas Beaded Ballpoint Pen Silicone Cartoon Santa Snowman Snowflake Decorative Beads Writing Office Stationery Holiday Gift
like
Find Similar
Detail of Christmas tree silicone topper with crystal rhinestones on a beaded ballpoint pen - Christmas Tree
Close-up of blue silicone snowflake bead pen with rhinestone spacers and festive patterns - Blue Snowflake
Detail of Santa Claus silicone bead and Ho! Ho! text print on the red Christmas ballpoint pen - Santa Claus
Christmas Beaded Ballpoint Pen Silicone Cartoon Santa Snowman Snowflake Decorative Beads Writing Office Stationery Holiday Gift
$1.70
Mix MOQ : 3
 · 
39 views
Free Shipping
Christmas Resin Figurine Ornament Hand Painted Retro Distressed Santa Claus Snowman For Desktop Home Decoration
Christmas Resin Figurine Ornament Hand Painted Retro Distressed Santa Claus Snowman For Desktop Home Decoration
like
Find Similar
Vintage snowman resin ornament with red hat and green gift box for Christmas decor - Snowman 1 (Holding Gift/Red Hat/Green Scarf)
Retro resin snowman figurine with red heart, Christmas holiday desktop decoration - Snowman 2 (Holding Heart/Red Hat/Polka Dot Scarf)
Hand-painted vintage resin snowman figurine with blue hat and red polka dot scarf - Snowman 3 (Holding Star/Blue Hat/Red Scarf)
Retro resin snowman figurine with teal hat and red scarf holding a green tree - Snowman 4 (Holding Pine Tree/Cyan Hat/Red Scarf)
+8
Christmas Resin Figurine Ornament Hand Painted Retro Distressed Santa Claus Snowman For Desktop Home Decoration
-5%
$1.59-2.41
No MOQ
Christmas Tablecloth And Chair Covers Polyester Rectangular Santa Claus Snowman Pattern Holiday Dining Room Table Decor American Style
Christmas Tablecloth And Chair Covers Polyester Rectangular Santa Claus Snowman Pattern Holiday Dining Room Table Decor American Style
like
Find Similar
Christmas tablecloth set with Santa patterns and red snowflake chair covers in cozy room - 140*100cm / Santa Claus & Bear
Christmas tablecloth and chair cover set with Santa Claus and red-blue festive patterns - 140*100cm / Blue Christmas
Christmas tablecloth set with red snowman patterns and matching festive chair covers - 140*100cm / Snowman
Red Christmas tablecloth featuring Santa and tree patterns for festive holiday dining decor - 140*100cm / Red Christmas
+39
Christmas Tablecloth And Chair Covers Polyester Rectangular Santa Claus Snowman Pattern Holiday Dining Room Table Decor American Style
$4.29-9.19
No MOQ
Christmas Shower Curtain Waterproof Polyester Santa Claus Snowman Xmas Tree Digital Print Decor For Bathroom With Hooks
Christmas Shower Curtain Waterproof Polyester Santa Claus Snowman Xmas Tree Digital Print Decor For Bathroom With Hooks
like
Find Similar
Waterproof Christmas shower curtain featuring Santa Claus, decorated tree, and fireplace - Santa Claus & Fireplace (24-1) / 90*180cm
Detail view of waterproof polyester Christmas shower curtain featuring snowman and tree - Snowy Night Fireworks Snowman (24-2) / 90*180cm
Christmas shower curtain featuring a decorated tree and fireplace scene on waterproof fabric - Christmas Tree & Blue Gifts (22SDYL4C) / 90*180cm
Detail showing Santa Claus and reindeer sleigh print on waterproof Christmas shower curtain - Santa Flying in Snowy Night (24-4) / 90*180cm
+31
NewChristmas Shower Curtain Waterproof Polyester Santa Claus Snowman Xmas Tree Digital Print Decor For Bathroom With Hooks
$6.48-10.23
No MOQ
Christmas Tapestry Wall Hanging Polyester Digital Printing Winter Holiday Backdrop Snowman Santa For Home Dorm Decor
Christmas Tapestry Wall Hanging Polyester Digital Printing Winter Holiday Backdrop Snowman Santa For Home Dorm Decor
like
Find Similar
Detail of Christmas tapestry featuring vintage lantern, pine cones, and snowy night scene - Style 1-Winter Lantern Snow / 150x130cm
Detailed Christmas tapestry with snowman and tree design in a cozy room setting - Style 2-Snowman Forest Night / 150x130cm
Christmas tree wall tapestry featuring cozy manor scene with gifts and warm red velvet curtains - Style 3-Manor Xmas Tree / 150x130cm
Christmas collage tapestry featuring red JOY text and snowman for wall decoration - Style 4-JOY Holiday Collage / 150x130cm
+31
Christmas Tapestry Wall Hanging Polyester Digital Printing Winter Holiday Backdrop Snowman Santa For Home Dorm Decor
-5%
$2.46-10.40
No MOQ
Christmas Tablecloth Polyester Holiday Dinner Party Decor Santa Snowman Snowflake Pattern Reusable Wrinkle Resistant Red
Christmas Tablecloth Polyester Holiday Dinner Party Decor Santa Snowman Snowflake Pattern Reusable Wrinkle Resistant Red
like
Find Similar
Rectangular Christmas tablecloth with Santa and snowman prints on a festive red fabric - 140x140cm / Style 03-Santa & Snowman
Christmas tablecloth featuring red and white snowman pattern for festive dining decor - 140x140cm / Style 04-Snowman & Pine
Christmas tablecloth featuring red and black plaid trees and snowflakes on a white background - 140x140cm / Style 05-Plaid Christmas Tree
Red Christmas tablecloth with white snowflake and reindeer prints with scalloped edges - 140x140cm / Style 07-Red White Pattern
+31
Christmas Tablecloth Polyester Holiday Dinner Party Decor Santa Snowman Snowflake Pattern Reusable Wrinkle Resistant Red
$4.90-10.37
Mix MOQ : 3
Christmas Gift Bags Burlap Velvet Knit 3D Santa Snowman Reindeer Doll Handheld Drawstring Holiday Party Favor Treats Holder
Christmas Gift Bags Burlap Velvet Knit 3D Santa Snowman Reindeer Doll Handheld Drawstring Holiday Party Favor Treats Holder
like
Find Similar
Christmas burlap gift bag featuring a 3D Santa Claus design and soft carry handle - Burlap Belt Santa Claus
Christmas gift bag with 3D plush bear, red burlap candy pouch for holiday decor - Burlap Belt Bear
Red burlap Christmas gift bag with 3D reindeer design and plush trim, size 20x20cm - Burlap Belt Reindeer
Christmas snowman burlap gift bag with red finish and plaid hat, 20x20cm apple bag - Burlap Belt Snowman
+31
Christmas Gift Bags Burlap Velvet Knit 3D Santa Snowman Reindeer Doll Handheld Drawstring Holiday Party Favor Treats Holder
-10%
$0.41-1.59
No MOQ
Christmas Stocking Holders For Mantel Metal Heavy Duty Hooks Reindeer Snowflake Tree Snowman Decor Silver Gold Black
Christmas Stocking Holders For Mantel Metal Heavy Duty Hooks Reindeer Snowflake Tree Snowman Decor Silver Gold Black
like
Find Similar
Set of 4 heavy duty gold metal Christmas stocking holders for fireplace mantels - Christmas Base Gold
Set of two silver metal Christmas stocking holders for fireplace mantels with sturdy base - Christmas Base Silver
Set of four heavy duty black metal fireplace mantel hooks for hanging Christmas stockings - Christmas Base Black
Detailed view of silver Christmas tree stocking holder hook for mantel decoration - Christmas Tree Hook + Base
+3
Christmas Stocking Holders For Mantel Metal Heavy Duty Hooks Reindeer Snowflake Tree Snowman Decor Silver Gold Black
$3.17-5.13
Mix MOQ : 2
Christmas Hanging Ornaments Hand Painted Glass Santa Snowman Tree Shapes Festive Holiday Tree Decoration Pendant
Christmas Hanging Ornaments Hand Painted Glass Santa Snowman Tree Shapes Festive Holiday Tree Decoration Pendant
like
Find Similar
Christmas snowman glass ornament with red hat and green scarf for tree decoration - Snowman
Santa Claus glass ornament with red and gold details for Christmas tree decoration - Santa Claus
Classic red Santa Claus hanging ornament with glitter details for Christmas tree decor - Santa Claus
Christmas tree shaped painted glass ornament with gold glitter lines and red baubles - Christmas Tree
+10
Christmas Hanging Ornaments Hand Painted Glass Santa Snowman Tree Shapes Festive Holiday Tree Decoration Pendant
$3.40-7.44
No MOQ
Free Shipping
Christmas Gift Bags Felt Knitted Fabric Candy Apple Pouch Santa Snowman Reindeer Drawstring Handle Holiday Party Decor
Christmas Gift Bags Felt Knitted Fabric Candy Apple Pouch Santa Snowman Reindeer Drawstring Handle Holiday Party Decor
like
Find Similar
Christmas Santa Claus drawstring gift bag in red plush with festive snowflake details - Velvet Large Head Gift Bag [Santa]
Red Christmas drawstring gift bag with 3D snowman, festive non-woven fabric, 23x20cm size - Velvet Large Head Gift Bag [Snowman]
Christmas Santa felt gift bag 15x18cm sized to fit one apple for holiday treat - Brushed Fabric Colorful Handbag [Santa]
Red Christmas felt bag with snowman and tree applique, 15x18cm gift pouch for candy - Brushed Fabric Colorful Handbag [Snowman]
+32
Christmas Gift Bags Felt Knitted Fabric Candy Apple Pouch Santa Snowman Reindeer Drawstring Handle Holiday Party Decor
-5%
$0.74-2.47
No MOQ
 · 
10 views
Christmas Socks Thick Warm Coral Fleece Fuzzy Fluffy Soft Winter Holiday Gift Santa Claus Snowman Patterns For Women Men
Christmas Socks Thick Warm Coral Fleece Fuzzy Fluffy Soft Winter Holiday Gift Santa Claus Snowman Patterns For Women Men
like
Find Similar
Christmas coral fleece sock set in red and white with Santa Claus motif in festive bauble - Without Pom Pom / Red Santa with Green Hat
Christmas coral fleece socks with red and green stripes, featuring gingerbread man patterns - Without Pom Pom / Red Green Striped Bear Stars
Plush white Christmas socks with reindeer pattern in a clear holiday gift ornament ball - Without Pom Pom / White Reindeer
Green Christmas coral fleece socks with candy cane pattern in a clear gift ornament ball - Without Pom Pom / Green Christmas Gift
+10
Christmas Socks Thick Warm Coral Fleece Fuzzy Fluffy Soft Winter Holiday Gift Santa Claus Snowman Patterns For Women Men
$0.86
Mix MOQ : 2
Christmas Chair Back Covers Linen Cotton Snowman Pattern Dining Room Party Decor Winter Holiday Dustproof Protectors
Christmas Chair Back Covers Linen Cotton Snowman Pattern Dining Room Party Decor Winter Holiday Dustproof Protectors
like
Find Similar
Christmas chair back covers set with watercolor snowman print and winter forest scene - Orange Hat Snowman Style (YT55-1)
Detailed view of two Christmas chair covers with snowman design in a festive dining room - Pink Hat Snowman Style (YT55-2)
Christmas snowman chair covers in blue and pink linen fabric for festive dining room decor - Blue and Pink Floral Snowman Style (YT55-3)
Linen Christmas chair covers featuring snowman watercolor prints for festive dining decor - Red Scarf Snowman Style (YT55-4)
+4
Christmas Chair Back Covers Linen Cotton Snowman Pattern Dining Room Party Decor Winter Holiday Dustproof Protectors
$2.45
Mix MOQ : 2
 · 
10 views
Christmas Stocking Hangers Mantel Hooks Metal Fireplace Hanger Snowflake Snowman Reindeer Christmas Tree Shaped Decor
Christmas Stocking Hangers Mantel Hooks Metal Fireplace Hanger Snowflake Snowman Reindeer Christmas Tree Shaped Decor
like
Find Similar
Silver S-shaped Christmas stocking hook with a 3D golden snowflake on metal disk - Snowflake (Gold & Silver)
Christmas stocking holder with golden reindeer motif for mantle and tabletop decor - Reindeer (Gold & Silver)
Christmas stocking holder with snowman figurine and silver S-hook for mantel decor - Snowman (Gold & Silver)
Christmas stocking holder with golden metal tree design and silver hook for fireplace - Christmas Tree (Gold & Silver)
+4
Christmas Stocking Hangers Mantel Hooks Metal Fireplace Hanger Snowflake Snowman Reindeer Christmas Tree Shaped Decor
-5%
$1.78-2.08
No MOQ
 · 
38 sold recently
Christmas Ballpoint Pen Plush Pom Pom Cartoon Santa Snowman Reindeer Novelty Stationery Holiday Gift For Kids Students
Christmas Ballpoint Pen Plush Pom Pom Cartoon Santa Snowman Reindeer Novelty Stationery Holiday Gift For Kids Students
like
Find Similar
Christmas reindeer ballpoint pen with brown plush pom pom and festive reindeer decor - Reindeer-1
Christmas snowman plush pen with white fluffy ball and festive red background - Snowman-1
Creative snowman plush pompom ballpoint pen with striped blue hat for holiday gifts - Snowman-3
Creative Christmas plush ball snowman ballpoint pen with white fur and black hat design - Snowman-5
+4
Christmas Ballpoint Pen Plush Pom Pom Cartoon Santa Snowman Reindeer Novelty Stationery Holiday Gift For Kids Students
$0.66
Mix MOQ : 5
 · 
11 views
Christmas Scarf Women Soft Acrylic Knitted Jacquard Scarf Snowman Santa Claus Christmas Tree Patterns Festive Holiday Scarf
Christmas Scarf Women Soft Acrylic Knitted Jacquard Scarf Snowman Santa Claus Christmas Tree Patterns Festive Holiday Scarf
like
Find Similar
Red Christmas faux cashmere scarf with snowman patterns and 170x30cm dimensions - Christmas Snowman Red
Big-size red Christmas scarf with festive bear, tree patterns, and white snowflakes - Christmas Tree Hollow Red
Deep green Christmas knit scarf with red trees and snowflake patterns, 170x30cm - Christmas Tree Green
Detail of green knit scarf featuring festive Santa Claus patterns and soft texture - Santa Claus Green
+4
Christmas Scarf Women Soft Acrylic Knitted Jacquard Scarf Snowman Santa Claus Christmas Tree Patterns Festive Holiday Scarf
$5.19
No MOQ
 · 
10 sold recently
Christmas Aluminum Foil Balloons Santa Claus Reindeer Christmas Tree Snowman Mylar Party Atmosphere Decorations
Christmas Aluminum Foil Balloons Santa Claus Reindeer Christmas Tree Snowman Mylar Party Atmosphere Decorations
like
Find Similar
5-piece Christmas balloon set with festive tree, stars, and red holiday ornaments - Gift Box Christmas Tree Set
5-piece Santa Claus foil balloon set with red stars and snowflakes for Christmas party decor - Santa and Reindeer
5-piece Christmas balloon set with red green and gold round and gift box foil balloons - Christmas Gift Box Set
5pc Christmas balloon set including gingerbread house and red stars for party decor - Gingerbread House Set
+6
Christmas Aluminum Foil Balloons Santa Claus Reindeer Christmas Tree Snowman Mylar Party Atmosphere Decorations
$1.07-1.38
Mix MOQ : 2
 · 
24 sold recently
Christmas Banner Hanging Garland Paper Merry Christmas Letter Cartoon Santa Snowman Decoration For Party Home Celebration
Christmas Banner Hanging Garland Paper Merry Christmas Letter Cartoon Santa Snowman Decoration For Party Home Celebration
like
Find Similar
Close-up of 8pcs cartoon Christmas paper banner featuring Santa and reindeer for party decor - Red Green Dots/Stripes Bunting
Merry Christmas felt banner with red and green letters and festive holiday tree patterns - Red Green White-Merry Christmas
Merry Christmas banner with Santa and snowman patterns, 15x16cm cards, 3m string length - Colorful Letters-Merry Christmas
Merry Christmas banner with Nordic gnomes and 3-meter rope for festive party decor - Gnomes-Merry Christmas
+17
Christmas Banner Hanging Garland Paper Merry Christmas Letter Cartoon Santa Snowman Decoration For Party Home Celebration
-5%
$0.38-0.77
No MOQ
Christmas Inflatable Outdoor Decoration With Built In Led Lights Santa Claus Snowman Arch For Yard Garden Lawn Party
Christmas Inflatable Outdoor Decoration With Built In Led Lights Santa Claus Snowman Arch For Yard Garden Lawn Party
like
Find Similar
Inflatable climbing Santa Claus with gift bag and internal LED lights for outdoor decor - 2M-Santa Claus with Green Bag
Outdoor inflatable climbing Santa Claus decoration with gift bag for Christmas mall displays - 2M-Santa Claus with White Bag
Inflatable Christmas bear outdoor decoration with LED lights and Merry Christmas bag base - 1.5M-Christmas Bear in Gift Bag
Giant inflatable Santa Claus with gift box climbing outdoor wall for Christmas decor - 1.5M-Santa Claus with Gift Box
+7
Christmas Inflatable Outdoor Decoration With Built In Led Lights Santa Claus Snowman Arch For Yard Garden Lawn Party
$68.59-140.63
No MOQ
Christmas Silicone Molds Reindeer Snowflake Snowman Gingerbread Man Holly Leaf For Fondant Chocolate Cake Decoration
Christmas Silicone Molds Reindeer Snowflake Snowman Gingerbread Man Holly Leaf For Fondant Chocolate Cake Decoration
like
Find Similar
Pink Christmas silicone mold set featuring Santa, snowman, reindeer and snowflake patterns - Set of 6 (Pink)
Pink silicone holly leaf mold with clear textures for Christmas fondant cake decoration - 3# Pink Holly Leaves
Pink silicone snowflake mold for Christmas baking and crafts, multi-cavity design - 4# Pink Snowflake
Pink silicone mold with Christmas elk and snowflake shapes for festive decorations - 5# Pink Reindeer Christmas Tree
+10
Christmas Silicone Molds Reindeer Snowflake Snowman Gingerbread Man Holly Leaf For Fondant Chocolate Cake Decoration
$0.43-3.60
No MOQ
Christmas Stockings Felt Plaid With 3D Santa Snowman Reindeer Bear Hanging Ornament Holiday Party Decor Gift Candy Bag
Christmas Stockings Felt Plaid With 3D Santa Snowman Reindeer Bear Hanging Ornament Holiday Party Decor Gift Candy Bag
like
Find Similar
Detail of red felt Christmas stocking with 3D snowman doll and snowflake embroidery - Small Bell Style Snowman (E3-1)
Detail of red Christmas stocking with reindeer head and snowflake pattern hanging on a rope - Small Bell Style Reindeer (E3-1)
Detail of red Christmas stocking with plaid trim and 3D plush bear hanging decoration - Small Bell Style Bear (E3-1)
Christmas stocking with Santa Claus applique and green sequin cuff in festive setting - Small Sequin Style Santa (E1-1)
+16
Christmas Stockings Felt Plaid With 3D Santa Snowman Reindeer Bear Hanging Ornament Holiday Party Decor Gift Candy Bag
-5%
$0.55
No MOQ
Christmas Window Clings Static Sticker PVC Double Sided Santa Snowman Reindeer Glass Door Holiday Party Home Decor
Christmas Window Clings Static Sticker PVC Double Sided Santa Snowman Reindeer Glass Door Holiday Party Home Decor
like
Find Similar
Christmas snowman static window cling sticker with Merry Christmas text for festive decor - Small 40x80cm / SDHZUV-15A Snowman
Christmas reindeer static window sticker with Merry Christmas text and white snowflakes - Small 40x80cm / SDHZUV-15B Reindeer
Christmas Santa static window sticker size chart with five available height specifications - Small 40x80cm / SDHZUV-15C Santa Claus
Christmas tree static window sticker with Merry Christmas text and double-sided green color - Small 40x80cm / SDHZUV-15D Christmas Tree
+16
Christmas Window Clings Static Sticker PVC Double Sided Santa Snowman Reindeer Glass Door Holiday Party Home Decor
$5.05-45.41
No MOQ
Christmas Snowman Plush Doll Knitted Hat Scarf Earmuff Desktop Ornament Holiday Home Window Display Nordic Style Decor
Christmas Snowman Plush Doll Knitted Hat Scarf Earmuff Desktop Ornament Holiday Home Window Display Nordic Style Decor
like
Find Similar
Christmas plush snowman decoration with ear muffs and welcome star tag, 17x30cm size - 17*30CM / Brown Earmuff Small Snowman
Three-piece set of red and cream Christmas snowman plush dolls with hats and scarves - Three-Piece Set / Red Earmuff Snowman Family of Three
Three plush Christmas snowman dolls with knit hats and scarves in a cozy holiday scene - Three-Piece Set / Brown Earmuff Snowman Family of Three
Christmas snowman plush doll in red sweater and brown knit hat, medium size 20x38cm - 20*38cm / Brown Earmuff Medium Snowman
+16
Christmas Snowman Plush Doll Knitted Hat Scarf Earmuff Desktop Ornament Holiday Home Window Display Nordic Style Decor
-5%
$3.01-164.27
No MOQ
Enamel Christmas Earrings For Women Alloy Resin Santa Snowman Tree Bell Holiday Festive Party Jewelry Novelty
Enamel Christmas Earrings For Women Alloy Resin Santa Snowman Tree Bell Holiday Festive Party Jewelry Novelty
like
Find Similar
Golden glitter Christmas tree earrings with round studs for festive holiday style - Gold Christmas Tree Studs
Festive gingerbread man earrings with red smile and yellow buttons on white background - Small Gingerbread Man Earrings
Cute white snowman earrings with festive red scarf and hat on silver hooks - White Snowman Earrings
Christmas drop earrings with colorful metal bells and pink resin donut charms - Bell Donut Earrings
+16
Enamel Christmas Earrings For Women Alloy Resin Santa Snowman Tree Bell Holiday Festive Party Jewelry Novelty
$0.47-1.21
Mix MOQ : 3
Free Shipping
Christmas Tie Glitter Felt Holiday Necktie For Kids Party Decor Cartoon Reindeer Snowman Santa Elf Adjustable Elastic Rope
Christmas Tie Glitter Felt Holiday Necktie For Kids Party Decor Cartoon Reindeer Snowman Santa Elf Adjustable Elastic Rope
like
Find Similar
Glittery yellow felt Christmas tie with HO HO HO 3D lettering and 25cm size detail - Gold HO HO HO Style
Glittery red Christmas tie with tree pattern for kids holiday dress up costumes - Red Christmas Tree Style
Golden sequin Christmas felt tie with gnome design and adjustable neck strap, 25cm - Gold Christmas Gnome Style
Red glitter Christmas tie for kids with snowman and snowflake decorations - Red Snowman Style
+16
Christmas Tie Glitter Felt Holiday Necktie For Kids Party Decor Cartoon Reindeer Snowman Santa Elf Adjustable Elastic Rope
$0.92
No MOQ
Christmas Stud Earrings Enamel Alloy Rhinestone With 925 Sterling Silver Earring Post Santa Snowman Tree Reindeer Bell
Christmas Stud Earrings Enamel Alloy Rhinestone With 925 Sterling Silver Earring Post Santa Snowman Tree Reindeer Bell
like
Find Similar
Detailed close-up of festive Christmas glove earrings with red enamel and golden snowflake - Christmas Mittens
Detailed view of Christmas reindeer stud earrings with red enamel and ruby gemstone accents - Christmas Reindeer
Close-up of red apple earrings with gold stem and green leaf detail for Christmas - Red Apple
Macro detail of Christmas tree stud earrings with vibrant red and green rhinestones - Rhinestone Christmas Tree
+12
Christmas Stud Earrings Enamel Alloy Rhinestone With 925 Sterling Silver Earring Post Santa Snowman Tree Reindeer Bell
$0.42-0.94
No MOQ
Free Shipping
Wooden Christmas 3D Desktop Ornament Laser Cut Winter Scene Snowman Truck Pine Tree House Natural Wood Festive Table Decor
Wooden Christmas 3D Desktop Ornament Laser Cut Winter Scene Snowman Truck Pine Tree House Natural Wood Festive Table Decor
like
Find Similar
3D wooden Christmas scene featuring a vintage truck, snowman and trees on a wooden base - 3D Stereoscopic Landscape (木工艺品-D)
Wooden Christmas 3D Desktop Ornament Laser Cut Winter Scene Snowman Truck Pine Tree House Natural Wood Festive Table Decor
$1.01
Mix MOQ : 20
 · 
20 sold recently
Christmas DIY Building Blocks Capsule Toys Santa Reindeer Snowman Mini Models Educational Gifts Plastic Holiday Party Favors
Christmas DIY Building Blocks Capsule Toys Santa Reindeer Snowman Mini Models Educational Gifts Plastic Holiday Party Favors
like
Find Similar
Christmas building block set with Santa, reindeer, and tree on white background - 12-in-1 Christmas Building Block Gashapon (1000)
Christmas DIY Building Blocks Capsule Toys Santa Reindeer Snowman Mini Models Educational Gifts Plastic Holiday Party Favors
$0.72
Mix MOQ : 12
 · 
14 views
Christmas Window Clings PVC Static Film Double Sided Santa Snowman Reindeer Snowflake Glass Decal Home Holiday Decor
Christmas Window Clings PVC Static Film Double Sided Santa Snowman Reindeer Snowflake Glass Decal Home Holiday Decor
like
Find Similar
Set of 9 double-sided pink Christmas window clings with Santa and Reindeer designs - Christmas Static Window Sticker A027 / 20cm*30cm (Set of 9 Sheets)
Christmas static window stickers set featuring 9 sheets of gingerbread man and candy patterns - Christmas Static Window Sticker A022 / 20cm*30cm (Set of 9 Sheets)
Detail showing 9 sheets of Christmas window clings with snowflakes and reindeer motifs - Christmas Static Window Sticker A021 / 20cm*30cm (Set of 9 Sheets)
Pink cartoon Christmas window clings set with Santa and reindeer motifs, 9-sheet kit - Christmas Static Window Sticker A2338 / 20cm*30cm (Set of 9 Sheets)
+31
Christmas Window Clings PVC Static Film Double Sided Santa Snowman Reindeer Snowflake Glass Decal Home Holiday Decor
$2.19
Mix MOQ : 2
Christmas Brooch Reindeer Snowman Snowflake Bell Zinc Alloy Rhinestone Artificial Pearl Enamel Pin For Women Men Holiday Gift
Christmas Brooch Reindeer Snowman Snowflake Bell Zinc Alloy Rhinestone Artificial Pearl Enamel Pin For Women Men Holiday Gift
like
Find Similar
Golden Christmas reindeer brooch with red gemstone and colorful wreath on white background - Wreath Reindeer (C367-A)
Christmas ice skate brooch with red poinsettia and candy cane on white background - Red Ice Skate (C380-A)
Silver snowflake brooch with red and green rhinestones, size 5x5cm, weighing 9.9g - Red Green Rhinestone Snowflake (C368-A)
Christmas reindeer brooch with white enamel, red rhinestones, and gold plating, 5.7cm - White Enamel Reindeer (C353-A)
+9
Christmas Brooch Reindeer Snowman Snowflake Bell Zinc Alloy Rhinestone Artificial Pearl Enamel Pin For Women Men Holiday Gift
-14%
$0.92-1.52
Mix MOQ : 3
 · 
22 views
Free Shipping
Christmas Plush Ornaments Snowman Reindeer Santa Angel Girl Hanging Decorations For Holiday Home Tree Decor Knit Fabric
Christmas Plush Ornaments Snowman Reindeer Santa Angel Girl Hanging Decorations For Holiday Home Tree Decor Knit Fabric
like
Find Similar
Plush Christmas snowman pendant in red and white knit hat, size 12cm by 7cm - Plush Snowman A
Plush Christmas snowman pendant with red white knit hat hanging on a green tree - Plush Snowman B
Plush Christmas snowman ornament with red checkered hat and white faux fur on a tree - Plush Snowman C
Plush Christmas snowman pendant with red hat and scarf, 11cm height tree decoration - Plush Snowman D
+9
Christmas Plush Ornaments Snowman Reindeer Santa Angel Girl Hanging Decorations For Holiday Home Tree Decor Knit Fabric
$2.25-3.23
No MOQ
Knitted Christmas Hair Clips Cute Santa Reindeer Snowman Crochet Hair Pins For Girls Women Xmas Holiday Party Hair Accessories
Knitted Christmas Hair Clips Cute Santa Reindeer Snowman Crochet Hair Pins For Girls Women Xmas Holiday Party Hair Accessories
like
Find Similar
Detailed macro view of handmade crochet Christmas bow hair clip with red and green yarn texture - Red and Green Bowknot (27706A)
Close-up of hand-knitted Christmas hair clip with red green yarn and white pearls - Rectangular Red and Green Pearl (27706B)
Close-up of handmade crochet Christmas hairpin with red flower and pearl detail - Oval Red Knot (27706C)
Close-up of handmade knitted Christmas hair clip with red and green festive wreath pattern - Green Disc Red Knot (27706D)
+13
Knitted Christmas Hair Clips Cute Santa Reindeer Snowman Crochet Hair Pins For Girls Women Xmas Holiday Party Hair Accessories
$0.86-1.30
No MOQ
Free Shipping
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access