Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Wooden Train Decoration Mini Desktop Ornament Cartoon Snowman Bear Figurines Holiday Home Party Display Gift
Christmas Wooden Train Decoration Mini Desktop Ornament Cartoon Snowman Bear Figurines Holiday Home Party Display Gift
like
Find Similar
Detail of wooden Christmas train with snowman and bear figures on a festive table - 4 Segments / Green
Close-up of red wooden Christmas train with snowman and bear on light wood surface - 4 Segments / Red
Detail of white and gold wooden Christmas train with miniature bear and snowman figurines - 4 Segments / White
Pink and gold Christmas wooden train ornament with snowman and bear figures - 4 Segments / Pink
+8
Christmas Wooden Train Decoration Mini Desktop Ornament Cartoon Snowman Bear Figurines Holiday Home Party Display Gift
$2.16-3.03
Mix MOQ : 2
Christmas Gift Label Stickers Coated Paper Self Adhesive To From Name Tags Reindeer Snowman Santa Patterns Holiday Party Decor
Christmas Gift Label Stickers Coated Paper Self Adhesive To From Name Tags Reindeer Snowman Santa Patterns Holiday Party Decor
like
Find Similar
2 options
Christmas Gift Label Stickers Coated Paper Self Adhesive To From Name Tags Reindeer Snowman Santa Patterns Holiday Party Decor
$0.86-1.30
No MOQ
 · 
23 sold recently
Christmas Throw Pillow Covers Linen Vintage Farmhouse Winter Holiday Decorative Cushion Cases Snowman Print Home Decor
Christmas Throw Pillow Covers Linen Vintage Farmhouse Winter Holiday Decorative Cushion Cases Snowman Print Home Decor
like
Find Similar
Detail of linen texture pillowcase with watercolor Nordic knit glove print decoration - Knit Mittens Pattern (DYM386-1)
Detailed close-up of retro Christmas snowman pillowcase with vintage books and ornaments - Vintage Books and Ornament Pattern (DYM386-2)
Winter owl print decorative throw pillow cover in vintage farmhouse linen style - Owl Watercolor Illustration (DYM386-3)
Linen Christmas pillow case featuring vintage hand-drawn gift and pinecone patterns - Christmas Gift Box and Pinecone (DYM386-4)
+10
Christmas Throw Pillow Covers Linen Vintage Farmhouse Winter Holiday Decorative Cushion Cases Snowman Print Home Decor
$1.30
Mix MOQ : 2
Christmas Kitchen Towels Microfiber Absorbent Dish Cloths Santa Snowman Gnome Printed Decorative Hand Towels For Home Decor
Christmas Kitchen Towels Microfiber Absorbent Dish Cloths Santa Snowman Gnome Printed Decorative Hand Towels For Home Decor
like
Find Similar
Christmas kitchen towel with watercolor gnome and festive tree print on white background - Christmas Gnome Style (MJBT61-1) / 40*60cm
Christmas kitchen towel featuring blue gnome pickup truck design and Let It Snow text - Let It Snow Style (MJBT61-2) / 40*60cm
Christmas tea towel with blue stripes and watercolor lantern print for festive kitchen decor - Blue Lantern Style (MJBT61-3) / 40*60cm
White Christmas kitchen tea towel featuring a snowman and tree print for holiday decor - Snowman Gift Box Style (MJBT61-4) / 40*60cm
+80
Christmas Kitchen Towels Microfiber Absorbent Dish Cloths Santa Snowman Gnome Printed Decorative Hand Towels For Home Decor
$1.27-1.41
Mix MOQ : 2
Christmas Keychain Zinc Alloy Enamel Santa Claus Snowman Elk Tree Bell Merry Christmas Bag Charm Pendant Festival Gift
Christmas Keychain Zinc Alloy Enamel Santa Claus Snowman Elk Tree Bell Merry Christmas Bag Charm Pendant Festival Gift
like
Find Similar
Golden Christmas keychain with enamel tree, sled, and bell charms on beige background - Christmas Bell Tree Boot
Christmas keychain with gold ring featuring gift box, wreath, and tree enamel charms - Christmas Tree Wreath Gift
Golden Merry Christmas keychain with snowman and tree pendants on pink background - Christmas Snowman Letter Tree
Detail of Christmas keychain with festive enamel snowman, duck, and stocking charms - Christmas Snowman Sock
+6
Christmas Keychain Zinc Alloy Enamel Santa Claus Snowman Elk Tree Bell Merry Christmas Bag Charm Pendant Festival Gift
-9%
$0.70
No MOQ
Nordic Christmas Linen Pillowcase Decorative Sofa Cushion Cover Santa Claus Snowman Reindeer Printed Holiday Home Decor Square Pillow Case
Nordic Christmas Linen Pillowcase Decorative Sofa Cushion Cover Santa Claus Snowman Reindeer Printed Holiday Home Decor Square Pillow Case
like
Find Similar
Classic square Christmas pillow cover featuring Santa and reindeer on white background - At 9 / 18x18 Inch
Christmas peach skin pillowcase with colorful city night architectural print on black fabric - In-32 / 18x18 Inch
Peach skin pillowcase featuring a festive Christmas tree print with red ornaments - Blue White Snowy Christmas Tree (ym-11)
Detail of Christmas pillowcase showing Santa Claus decorating a tree in a snowy town - At 18 / 18x18 Inch
+34
Nordic Christmas Linen Pillowcase Decorative Sofa Cushion Cover Santa Claus Snowman Reindeer Printed Holiday Home Decor Square Pillow Case
-4%
$1.15
Mix MOQ : 2
Christmas Rectangular Tablecloth Polyester Festive Scalloped Edge Table Cover Santa Snowman Printing For Holiday Dining Party Home Decoration
Christmas Rectangular Tablecloth Polyester Festive Scalloped Edge Table Cover Santa Snowman Printing For Holiday Dining Party Home Decoration
like
Find Similar
Christmas red plaid tablecloth with festive pine needles and gingerbread man patterns - 140*100cm / Christmas Red Plaid
Christmas table runner with snowman and snowflake prints in red festive design - 140*100cm / Snowman
Christmas star sky tablecloth with Nutcracker and Santa Claus motifs on festive wooden table - 140*100cm / Christmas Bear Gift
Christmas tablecloth with festive prints and scalloped edges for holiday table decoration - 140*100cm / Christmas Bell
+34
Christmas Rectangular Tablecloth Polyester Festive Scalloped Edge Table Cover Santa Snowman Printing For Holiday Dining Party Home Decoration
-4%
$4.08-10.11
No MOQ
Christmas Miniature Figurines Resin Santa Claus Snowman Reindeer Tree Micro Landscape Garden Desktop Holiday Decor Cartoon
Christmas Miniature Figurines Resin Santa Claus Snowman Reindeer Tree Micro Landscape Garden Desktop Holiday Decor Cartoon
like
Find Similar
Miniature Christmas reindeer resin ornament with bell and red collar 3.5cm x 3cm - Reindeer
Miniature red Christmas sleigh model with dimensions 6.2cm length and 3.6cm height - Sled
Miniature Santa Claus figurine holding a green gift bag with 3.7cm height dimensions - Santa Claus with Gift Bag
Macro shot of miniature Santa Claus figurine holding a gift box with 3.2cm size specs - Santa Claus with Gift Box
+4
Christmas Miniature Figurines Resin Santa Claus Snowman Reindeer Tree Micro Landscape Garden Desktop Holiday Decor Cartoon
-4%
$0.69-0.96
Mix MOQ : 10
 · 
18 sold recently
Free Shipping
Christmas Inflatable Foil Balloons Cartoon Santa Claus Snowman Reindeer Headbands Wristbands Holiday Party Decorations Favors
Christmas Inflatable Foil Balloons Cartoon Santa Claus Snowman Reindeer Headbands Wristbands Holiday Party Decorations Favors
like
Find Similar
Inflatable Christmas headband with Santa Claus cartoon motif for holiday party decor - Christmas Headband Balloon
Christmas Inflatable Foil Balloons Cartoon Santa Claus Snowman Reindeer Headbands Wristbands Holiday Party Decorations Favors
$0.06
No MOQ
 · 
30 sold recently
LED Christmas Window Hanging Lights Suction Cup Battery Operated Plastic Warm White Glow Santa Snowman Patterns Indoor Decor
LED Christmas Window Hanging Lights Suction Cup Battery Operated Plastic Warm White Glow Santa Snowman Patterns Indoor Decor
like
Find Similar
LED Christmas suction cup hanging light with Santa pattern for holiday window decor - Smoking Santa Claus
LED Christmas suction cup light with windmill snow house pattern and warm glow - Windmill Snow House
LED Christmas light hanging featuring Santa Claus design with 14cm diameter disk - Santa Claus
LED Christmas snowman hanging light with Merry Christmas candy cane motif and battery box - Christmas Together
+13
LED Christmas Window Hanging Lights Suction Cup Battery Operated Plastic Warm White Glow Santa Snowman Patterns Indoor Decor
$2.54-2.68
No MOQ
Christmas Acrylic Dangle Earrings With Stainless Steel Earring Post Cartoon Snowman Xmas Tree Santa Holiday Jewelry Women
Christmas Acrylic Dangle Earrings With Stainless Steel Earring Post Cartoon Snowman Xmas Tree Santa Holiday Jewelry Women
like
Find Similar
Christmas tree earrings with gold star and red green beads on a clean white background - Star Christmas Tree
Festive Christmas gift box earrings in red and green acrylic print for women - Christmas Gift Box
Festive Christmas tree acrylic earrings with white body and red star topper decoration - Christmas Tree
Christmas acrylic earrings with red heart and white wreath pendants on white background - Christmas Wreath
+13
Christmas Acrylic Dangle Earrings With Stainless Steel Earring Post Cartoon Snowman Xmas Tree Santa Holiday Jewelry Women
-11%
$0.85
Mix MOQ : 2
 · 
20 views
Free Shipping
Christmas Plush Pendant Ornaments Soft Stuffed Tree Hanging Decorations Gingerbread Man Snowman Reindeer For Holiday Party Bag Charm
Christmas Plush Pendant Ornaments Soft Stuffed Tree Hanging Decorations Gingerbread Man Snowman Reindeer For Holiday Party Bag Charm
like
Find Similar
Close-up of a plush green Christmas wreath ornament with a red bow on a handbag strap - Flower Garland
Close-up of a plush red and white Christmas hat pendant with soft furry texture - Hat
Close-up of a red and white plush glove ornament hanging on a woven bag with a green hook - Gloves
Close-up of a plush red and green Christmas stocking pendant hanging on a handbag - Socks
+4
Christmas Plush Pendant Ornaments Soft Stuffed Tree Hanging Decorations Gingerbread Man Snowman Reindeer For Holiday Party Bag Charm
$1.99-2.85
No MOQ
 · 
30 views
Free Shipping
Christmas Tablecloth Rectangular Polyester Holiday Table Cover With Christmas Tree Snowman Elk Print For Dining Room Party Decor
Christmas Tablecloth Rectangular Polyester Holiday Table Cover With Christmas Tree Snowman Elk Print For Dining Room Party Decor
like
Find Similar
Christmas tablecloth with green tree patterns and festive decorations in a home setting - 140*100cm / Christmas Tree
Red Christmas tablecloth featuring Santa and tree patterns for festive holiday dining decor - 140*100cm / Red Christmas
Blue Christmas tablecloth and red chair covers with Santa Claus in festive room - 140*100cm / Blue Christmas
Red Christmas tablecloth with snowman and fir tree patterns in a cozy home setting - 140*100cm / Snowman
+39
NewChristmas Tablecloth Rectangular Polyester Holiday Table Cover With Christmas Tree Snowman Elk Print For Dining Room Party Decor
-4%
$4.08-8.74
No MOQ
Resin Miniature Christmas Tree Figurines Snowman Gift Box Ornaments Micro Landscape Desktop Fairy Garden Decoration
Resin Miniature Christmas Tree Figurines Snowman Gift Box Ornaments Micro Landscape Desktop Fairy Garden Decoration
like
Find Similar
Miniature green Christmas tree with gold star for DIY microlandscape, 5.3x2.6 cm - Christmas Tree No. 1 (5.3x2.6cm)
Green miniature Christmas tree with white snow glitter finish, 5cm height version - Christmas Tree No. 2 (5x2.6cm)
Miniature green Christmas tree with gold star and red ornaments, 4cm height variant - Christmas Tree No. 6 (4x2.6cm)
Miniature green Christmas tree figurine with red bow and size dimensions 3.5x2.5cm - Christmas Tree No. 7 (3.5x2.5cm)
+3
Resin Miniature Christmas Tree Figurines Snowman Gift Box Ornaments Micro Landscape Desktop Fairy Garden Decoration
$0.14-0.27
Mix MOQ : 3
Christmas Gift Bags Kraft Paper Cartoon Snowflake Snowman Tree Print Holiday Party Favor Treat Packaging
Christmas Gift Bags Kraft Paper Cartoon Snowflake Snowman Tree Print Holiday Party Favor Treat Packaging
like
Find Similar
Detail of kraft paper gift bag featuring a festive snowman print for Christmas packaging - Snowman
Brown kraft paper Christmas gift bag with festive sleigh and gift box illustration - Sleigh and Gift Box
Brown kraft paper Christmas gift bag featuring blue and white snowflake patterns - Blue Snowflake
Brown kraft paper Christmas gift bag with wreath and Merry Christmas print - Christmas Wreath
+1
Christmas Gift Bags Kraft Paper Cartoon Snowflake Snowman Tree Print Holiday Party Favor Treat Packaging
$0.10
Mix MOQ : 50
 · 
664 sold recently
Christmas Ornament Santa Claus Snowman Resin Figurine Miniature Desktop Holiday Decoration Vintage Style Home Decor
Christmas Ornament Santa Claus Snowman Resin Figurine Miniature Desktop Holiday Decoration Vintage Style Home Decor
like
Find Similar
Resin snowman figurine Christmas table decoration with snow base 8x5cm vintage style - 1690 Snowman (Single)
Resin Santa Claus ornament with gift and wreath, holiday tabletop decor, 12x9cm size - 18062 Santa Claus (Single)
Retro resin snowman figurine with red scarf and snowflake texture, 10x10cm holiday decor - 18062 Snowman (Single)
Resin snowman head figurine with red Christmas hat and orange bow, 5.5x5cm size - Snowman Head (Single)
+4
Christmas Ornament Santa Claus Snowman Resin Figurine Miniature Desktop Holiday Decoration Vintage Style Home Decor
-5%
$1.97-11.55
No MOQ
Christmas Charm Bracelet With Alloy Copper Snake Chain Colorful Glass Beads Santa Snowman Tree Pendants For Girls
Christmas Charm Bracelet With Alloy Copper Snake Chain Colorful Glass Beads Santa Snowman Tree Pendants For Girls
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - Bright Silver Bangle 18cm
Festive Christmas charm bracelet with snowman, tree, and candy cane beads in red and green - SD-0018 Red Santa Claus Style
Christmas beaded bracelet with red green crystals and festive Santa charms on white background - SD-0014 Green Snow House Style
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - Lobster Clasp Snake Bone Basic Chain 18+5cm
+3
Christmas Charm Bracelet With Alloy Copper Snake Chain Colorful Glass Beads Santa Snowman Tree Pendants For Girls
$0.73-3.30
No MOQ
Free Shipping
Christmas Wine Bottle Gift Bags Kraft Paper Cartoon Santa Claus Snowman Patterns Festive Holiday Party Table Decoration
Christmas Wine Bottle Gift Bags Kraft Paper Cartoon Santa Claus Snowman Patterns Festive Holiday Party Table Decoration
like
Find Similar
Christmas kraft paper wine gift bag with cartoon Santa Claus and gift box patterns - Santa with Hat
Christmas kraft paper wine bag with Santa Claus illustrations on a rustic table - Classic Santa Claus
Christmas snowman kraft paper wine gift bag with sturdy handles for festive table decor - Snowman
Christmas Kraft paper wine bag with candle and wreath prints for festive table decor - Christmas Wreath
Christmas Wine Bottle Gift Bags Kraft Paper Cartoon Santa Claus Snowman Patterns Festive Holiday Party Table Decoration
-4%
$0.41
No MOQ
 · 
49 sold recently
Merry Christmas Peach Skin Pillowcase Vintage Winter Oil Painting Cushion Cover Festive Snowman Reindeer Home Decor Case
Merry Christmas Peach Skin Pillowcase Vintage Winter Oil Painting Cushion Cover Festive Snowman Reindeer Home Decor Case
like
Find Similar
Merry Christmas peach skin pillowcase featuring ice skating scene and holiday tree - Skating Christmas Tree Style (ZT435-1)
Merry Christmas peach skin pillowcase with Santa driving retro car and cute dogs - Santa Convertible Car Style (ZT435-2)
Christmas cushion cover with peach skin texture featuring kids and reindeer in snow - Kids Reindeer Fence Style (ZT435-3)
Square peach skin pillowcase with winter oil painting scene of children and donkeys - Snow Kids and Donkey Style (ZT435-4)
+36
Merry Christmas Peach Skin Pillowcase Vintage Winter Oil Painting Cushion Cover Festive Snowman Reindeer Home Decor Case
-4%
$1.04
No MOQ
Christmas Snowman Throw Pillowcase Soft Short Plush Decorative Cushion Cover Winter Holiday Home Sofa Decor
Christmas Snowman Throw Pillowcase Soft Short Plush Decorative Cushion Cover Winter Holiday Home Sofa Decor
like
Find Similar
White Christmas pillowcase featuring watercolor snowman family in winter holiday style - Style 1
Christmas snowman pillow cover with champagne illustration on white fabric - Style 2
Christmas snowman and golden sleigh pillow cover for elegant holiday home decoration - Style 3
Christmas snowman cushion cover with blue scarf and gold gift boxes on white fabric - Style 4
+26
Christmas Snowman Throw Pillowcase Soft Short Plush Decorative Cushion Cover Winter Holiday Home Sofa Decor
$1.30
Mix MOQ : 2
Christmas Table Runner Polyester Cotton Jacquard Snowman Penguin Pattern Holiday Dining Party Decoration With Tassels
Christmas Table Runner Polyester Cotton Jacquard Snowman Penguin Pattern Holiday Dining Party Decoration With Tassels
like
Find Similar
Christmas snowman table runner with red poinsettia and green holly patterns - 35*140cm / Poinsettia + Ball
Christmas table runner with red poinsettia and candles on beige jacquard fabric - 35*140cm / Poinsettia + Candle
Christmas snowman table runner with red tassels on a wooden dining table setup - 35*140cm / Christmas Sock & Triangle
Christmas snowman and gingerbread man table runner with tassels on a wooden dining table - 35*140cm / Snowman & Gingerbread
+31
Christmas Table Runner Polyester Cotton Jacquard Snowman Penguin Pattern Holiday Dining Party Decoration With Tassels
$3.75-6.34
No MOQ
Christmas Hair Claw Clips Large Rectangular Acrylic Santa Reindeer Snowman Print Holiday Party Accessories For Women
Christmas Hair Claw Clips Large Rectangular Acrylic Santa Reindeer Snowman Print Holiday Party Accessories For Women
like
Find Similar
Detail of white Christmas hair claw clip with festive elk and Santa prints on red plaid - White
Macro detail of red Christmas hair claw clip with snowman and bell prints on festive tray - Red
Detail of Christmas hair claw clip with reindeer and snowman print on green acrylic - Green
Detail of transparent Christmas acrylic hair claw clip with festive elk and snowman patterns - Clear
+7
Christmas Hair Claw Clips Large Rectangular Acrylic Santa Reindeer Snowman Print Holiday Party Accessories For Women
$0.39
No MOQ
Christmas Plush Doll Ornament Santa Claus Snowman Reindeer Knitted Tabletop Figurine Holiday Home Decoration Gift
Christmas Plush Doll Ornament Santa Claus Snowman Reindeer Knitted Tabletop Figurine Holiday Home Decoration Gift
like
Find Similar
Christmas snowman plush doll wearing a checkered hat and golden boots on a snow surface - 30CM Gold Snowman Style
Christmas gnome plush with tall white knit hat and golden boots on a snow base - 30CM Gold Santa Style
Christmas gnome doll with knitted hat and gold shoes on snowy background - 50CM Gold Santa Style
Pink knitted Christmas gnome plush doll with white beard and grey boots on fake snow - 30CM Pink Santa Style
+7
Christmas Plush Doll Ornament Santa Claus Snowman Reindeer Knitted Tabletop Figurine Holiday Home Decoration Gift
$8.65-13.26
No MOQ
Christmas Stud Earrings Alloy Enamel Drip Oil Santa Claus Snowman Reindeer Tree Wreath Holiday Party Cute Festive Gift
Christmas Stud Earrings Alloy Enamel Drip Oil Santa Claus Snowman Reindeer Tree Wreath Holiday Party Cute Festive Gift
like
Find Similar
Festive Christmas tree stud earrings with colorful enamel layers and golden dot accents - Star Christmas Tree
Festive Christmas reindeer stud earrings in red and gold enamel finish for women - Red Nose Reindeer
Cute Christmas snowman stud earrings with white and red oil drop finish on gold metal - Cartoon Red Scarf Snowman
Christmas gift box stud earrings in gold, red and white enamel with ribbon bow - Red Ribbon Gift Box
+7
Christmas Stud Earrings Alloy Enamel Drip Oil Santa Claus Snowman Reindeer Tree Wreath Holiday Party Cute Festive Gift
$0.29-0.47
No MOQ
Free Shipping
Christmas Plush Dolls Retractable Telescopic Legs Santa Snowman Reindeer Home Decoration Festive Desktop Long Legged
Christmas Plush Dolls Retractable Telescopic Legs Santa Snowman Reindeer Home Decoration Festive Desktop Long Legged
like
Find Similar
Extendable Christmas snowman plush with vintage green plaid hat and red scarf decoration - Extendable Snowman
Telescopic Christmas reindeer plush doll with red and green plaid pattern and long legs - Extendable Reindeer
Standing Santa Claus plush doll with telescopic long legs and red plaid holiday outfit - Santa Claus (Non-extendable)
Christmas snowman doll with telescopic long legs, red plaid hat and festive pine needles - Snowman (Non-extendable)
+7
Christmas Plush Dolls Retractable Telescopic Legs Santa Snowman Reindeer Home Decoration Festive Desktop Long Legged
$4.24-5.48
No MOQ
 · 
16 sold recently
Christmas Throw Pillow Covers Linen Blend Reindeer Snowflake Snowman Merry Christmas Decorative Cushion Covers For Home Sofa
Christmas Throw Pillow Covers Linen Blend Reindeer Snowflake Snowman Merry Christmas Decorative Cushion Covers For Home Sofa
like
Find Similar
Linen Christmas pillow case with purple Merry Christmas elk print on beige fabric - Purple Merry Christmas & Reindeer Style (YMX86-1)
Purple Christmas cushion cover with white snowman and snowflake print on linen fabric - Purple With White Snowman Style (YMX86-2)
Deep purple linen Christmas pillowcase with white reindeer and snowflake pattern - Purple With White Scroll Reindeer Style (YMX86-3)
Christmas reindeer and snowflake print cushion cover in natural linen with purple motifs - Beige With Purple Christmas Trees Style (YMX86-4)
+24
Christmas Throw Pillow Covers Linen Blend Reindeer Snowflake Snowman Merry Christmas Decorative Cushion Covers For Home Sofa
$1.15
Mix MOQ : 2
Christmas Round Placemats Linen Heat Resistant Washable Dining Table Decor Snowman Tree Truck Gnome Pattern Festive Holiday
Christmas Round Placemats Linen Heat Resistant Washable Dining Table Decor Snowman Tree Truck Gnome Pattern Festive Holiday
like
Find Similar
Close-up of a red round linen Christmas placemat with gnomes and a vintage truck decor - Red Holiday Truck (XRP002)
Round red Christmas placemat with snowman pattern and Let It Snow text on wood table - Snowman and LET IT SNOW (XRP003)
Linen Christmas placemat with festive pine and Merry Christmas print on wooden table - Plaid Christmas Balls (XRP044)
Round linen Christmas placemat with red plaid trees and Merry Christmas text decor - Three Plaid Christmas Trees (XRP059)
+24
Christmas Round Placemats Linen Heat Resistant Washable Dining Table Decor Snowman Tree Truck Gnome Pattern Festive Holiday
$1.01
Mix MOQ : 2
Christmas Table Runner And Placemats Linen Printed Heat Resistant Xmas Party Dining Decoration Snowflake Santa Snowman
Christmas Table Runner And Placemats Linen Printed Heat Resistant Xmas Party Dining Decoration Snowflake Santa Snowman
like
Find Similar
Detailed size specification for snowman printed linen table runner and placemats set - Beige Let It Snow Style (4) / Table Runner And Placemats Set
Linen Christmas table runner and 6 placemats set with vintage pine trees and greeting - Pine Tree Text Style (11)
Christmas Buffalo Plaid Table Runner and Placemats Set with Merry Christmas Print - Buffalo Plaid Christmas Tree (21) / Table Runner And Placemats Set
Linen Christmas table runner and 6 placemats set with red buffalo plaid snowman print - Black Red Plaid Snowman (12) / Table Runner And Placemats Set
+24
Christmas Table Runner And Placemats Linen Printed Heat Resistant Xmas Party Dining Decoration Snowflake Santa Snowman
$5.19
Mix MOQ : 2
Christmas Pillowcase Short Velvet Cushion Cover Single Sided Digital Print Festive Home Sofa Balcony Decoration Snowman
Christmas Pillowcase Short Velvet Cushion Cover Single Sided Digital Print Festive Home Sofa Balcony Decoration Snowman
like
Find Similar
Christmas pillow cover with Joy to the World text and red plaid tree design - TQR31-1/Joy to the World Xmas Tree
Christmas pillowcase with Santa Claus in black and white checkered pattern and snowflakes - TQR31-2/Merry Christmas Santa
Christmas pillowcase with snowman print and black and white checkered border design - TQR31-3/Love Christmas Snowman
My First Christmas pillow cover with red plaid hat and black checkered border - TQR31-4/My First Christmas Hat
+24
Christmas Pillowcase Short Velvet Cushion Cover Single Sided Digital Print Festive Home Sofa Balcony Decoration Snowman
$1.30
Mix MOQ : 2
Christmas Fridge Magnets DIY Snowman Santa Reindeer Gnome Soft Magnetic Stickers For Kitchen Holiday Home Decor
Christmas Fridge Magnets DIY Snowman Santa Reindeer Gnome Soft Magnetic Stickers For Kitchen Holiday Home Decor
like
Find Similar
DIY Christmas snowman magnetic fridge stickers with hat, carrot nose and red scarf decor - Snowman-1
Christmas Santa Claus fridge magnet set with candy canes and gingerbread man on silver fridge - Santa Claus-1
Christmas gnome magnet set with red buffalo plaid hats and Merry Christmas text - Gnome-2
Christmas gnome magnet set for fridge including candy cane and gingerbread man decor - Gnome-1
+6
Christmas Fridge Magnets DIY Snowman Santa Reindeer Gnome Soft Magnetic Stickers For Kitchen Holiday Home Decor
$2.19
No MOQ
Christmas Retractable Plush Doll Santa Snowman Reindeer Ornament Knitted Red Black Plaid Nordic Standing Decor Holiday
Christmas Retractable Plush Doll Santa Snowman Reindeer Ornament Knitted Red Black Plaid Nordic Standing Decor Holiday
like
Find Similar
Cute 45cm Santa Claus doll in red plaid fabric for Christmas interior decoration - Santa Claus (45cm)
Standing Christmas snowman doll in red reindeer knit sweater with plaid hat, 43cm tall - Snowman (43cm)
Standing Christmas reindeer doll with red plaid shirt and festive hat decoration 46cm - Reindeer (46cm)
Red plaid retractable Santa Claus doll, Christmas decoration height 58cm - Retractable Santa Claus (58cm)
+5
Christmas Retractable Plush Doll Santa Snowman Reindeer Ornament Knitted Red Black Plaid Nordic Standing Decor Holiday
-5%
$8.21-12.59
Mix MOQ : 2
 · 
33 views
Mixed Christmas Alloy Enamel Charms Santa Snowman Elk Penguin For DIY Jewelry Making Festive Cartoon Style
Mixed Christmas Alloy Enamel Charms Santa Snowman Elk Penguin For DIY Jewelry Making Festive Cartoon Style
like
Find Similar
Detail of gingerbread man metal charms with yellow enamel finish for DIY jewelry - Gingerbread Man
Detail of penguin Christmas charm with enamel finish and gold metal back size 25mm - Ringing Christmas Penguin
Detailed Santa Claus enamel charm dimensions 25x20mm for Christmas DIY jewelry making - Piano Santa Claus
Detail view of colorful enamel Christmas reindeer charm with size 25mm x 16mm - Small Elk
+5
Mixed Christmas Alloy Enamel Charms Santa Snowman Elk Penguin For DIY Jewelry Making Festive Cartoon Style
$0.12-0.14
No MOQ
Free Shipping
Christmas Hair Clips Acetate Snowflake Santa Snowman Rhinestone Cute Festive Hair Accessories For Women Girls
Christmas Hair Clips Acetate Snowflake Santa Snowman Rhinestone Cute Festive Hair Accessories For Women Girls
like
Find Similar
Cute acetate snowman hair clip with red hat and candy gourd design for women - Snowman Candied Haws
Sparkling white acetate snowflake hair clip with rhinestones for Christmas festive styles - White Texture Snowflake
Detailed close-up of a snowman hair clip with blue hat and scarf in polished acetate - Snowman with Blue Scarf
Close-up of a cute white cloud snowman hair clip with a red Christmas hat and pink cheeks - Snowman with White Face and Red Hat
+3
Christmas Hair Clips Acetate Snowflake Santa Snowman Rhinestone Cute Festive Hair Accessories For Women Girls
$3.03-3.89
No MOQ
Free Shipping
Christmas LED Lantern Retro Decorative Wind Lamp With Hanging Ring Santa Claus Snowman Pattern Night Light Holiday Ornament
Christmas LED Lantern Retro Decorative Wind Lamp With Hanging Ring Santa Claus Snowman Pattern Night Light Holiday Ornament
like
Find Similar
Vintage Christmas lantern with reindeer scene and warm LED light in black gold finish - Bronze Reindeer / Bronze
Red Christmas LED lantern with festive Santa illustrations and metal hanging ring - Red Santa / Red
White Christmas LED lantern with elk forest scene and festive gift box background decoration - White Deer / White
White Christmas LED lantern with angel design and hanging ring for holiday decor - White Angel / White
+3
Christmas LED Lantern Retro Decorative Wind Lamp With Hanging Ring Santa Claus Snowman Pattern Night Light Holiday Ornament
$2.16
Mix MOQ : 2
 · 
17 views
Christmas Drop Earrings Acrylic Santa Claus Snowman Snowflake Bell Xmas Holiday Party Festive Jewelry For Women
Christmas Drop Earrings Acrylic Santa Claus Snowman Snowflake Bell Xmas Holiday Party Festive Jewelry For Women
like
Find Similar
Festive Santa Claus acrylic drop earrings with red hat and golden hooks on stone - Santa Claus
Festive Christmas snowman earrings in white acrylic with red scarf and gold hooks - Snowman
Christmas tree acrylic earrings with festive Santa and bell charms in green finish - Christmas Tree
Close-up of acrylic Christmas earrings with snowman and snowflake patterns on stone background - Light Blue Winter Theme
+3
Christmas Drop Earrings Acrylic Santa Claus Snowman Snowflake Bell Xmas Holiday Party Festive Jewelry For Women
-5%
$0.95
Mix MOQ : 2
 · 
11 sold recently
Free Shipping
Christmas Wine Glass Decoration Identifiers Flannel Felt Santa Snowman Reindeer Charms For Holiday Party Table Decor
Christmas Wine Glass Decoration Identifiers Flannel Felt Santa Snowman Reindeer Charms For Holiday Party Table Decor
like
Find Similar
Christmas Santa Claus wine glass plush charm decoration for festive holiday stemware - Santa Claus
Cute snowman plush wine glass decoration with red scarf and green hat for Christmas - Snowman
Christmas reindeer plush wine glass charm holder with green scarf for holiday party decor - Reindeer
Gingerbread man plush Christmas decoration with chef hat and striped scarf detail - Gingerbread Man
+3
Christmas Wine Glass Decoration Identifiers Flannel Felt Santa Snowman Reindeer Charms For Holiday Party Table Decor
-4%
$0.69
No MOQ
 · 
156 sold recently
Free Shipping
Christmas Snow Globe Lantern Vintage Street Lamp Style Lighted Ornament With Santa Claus Snowman Retro Bronze Home Decor
Christmas Snow Globe Lantern Vintage Street Lamp Style Lighted Ornament With Santa Claus Snowman Retro Bronze Home Decor
like
Find Similar
Retro bronze Christmas lantern featuring Santa on a sleigh with swirling snow effect - Large Street Lamp - Santa Claus
Bronze Christmas street lamp globe with snowman and children figures and warm LED light - Large Street Lamp - Snowman
Christmas Snow Globe Lantern Vintage Street Lamp Style Lighted Ornament With Santa Claus Snowman Retro Bronze Home Decor
$15.71
Mix MOQ : 2
 · 
19 views
Pink Christmas Plush Ornament Santa Claus Snowman Reindeer Knitted Fabric Telescopic Legs Desktop Decoration Home Holiday Party
Pink Christmas Plush Ornament Santa Claus Snowman Reindeer Knitted Fabric Telescopic Legs Desktop Decoration Home Holiday Party
like
Find Similar
Pink snowman gnome plush with glitter hat and polka dot overalls for Christmas decor - Sitting Snowman - Boy Style
Pink plush snowman gnome decoration with knitted hat and measurements 17x18cm - Sitting Snowman - Girl Style
Pink Christmas gnome figurine with polka dot hat and silver belt, standing decoration - Standing Santa Claus
Pink and grey plush Christmas reindeer gnome doll, knitted sweater decor, 40cm height - Standing-Reindeer
+13
Pink Christmas Plush Ornament Santa Claus Snowman Reindeer Knitted Fabric Telescopic Legs Desktop Decoration Home Holiday Party
-5%
$8.16-60.56
No MOQ
Christmas Cartoon Embroidery Patches Iron On Sew On Fabric Badges For DIY Clothing Backpack Holiday Decoration Snowman Reindeer
Christmas Cartoon Embroidery Patches Iron On Sew On Fabric Badges For DIY Clothing Backpack Holiday Decoration Snowman Reindeer
like
Find Similar
Detailed size specifications for a cute polar bear embroidered Christmas patch - Style 1# (Polar Bear)
Detailed embroidery of reindeer and Christmas stocking patches with precise dimensions - Style 2# (Reindeer)
Christmas sloth embroidery patch dimensions showing 6.6cm width and 3cm height with 0.9g weight - Style 3# (Sloth)
Detailed size chart for a cute snowman embroidery patch with precise dimensions - Style 4# (Snowman)
+13
Christmas Cartoon Embroidery Patches Iron On Sew On Fabric Badges For DIY Clothing Backpack Holiday Decoration Snowman Reindeer
$0.17-5.29
No MOQ
Free Shipping
Christmas Ceramic Travel Mug With Silicone Lid Santa Claus Snowman Pattern Reusable Festive Coffee Cup Holiday Gift
Christmas Ceramic Travel Mug With Silicone Lid Santa Claus Snowman Pattern Reusable Festive Coffee Cup Holiday Gift
like
Find Similar
Christmas travel mug with red silicone lid and festive Santa gift box packaging - 580ml / Snowman
Christmas Santa ceramic travel mug with red silicone lid and festive gift box packaging - 580ml / Santa Claus
Christmas Ceramic Travel Mug With Silicone Lid Santa Claus Snowman Pattern Reusable Festive Coffee Cup Holiday Gift
$3.29
Mix MOQ : 2
 · 
27 sold recently
Alloy Christmas Brooch Pin Santa Claus Reindeer Snowman Christmas Tree Enamel Badges Holiday Party Decoration Jewelry Gift For Women
Alloy Christmas Brooch Pin Santa Claus Reindeer Snowman Christmas Tree Enamel Badges Holiday Party Decoration Jewelry Gift For Women
like
Find Similar
Cartoon Christmas tree enamel brooch with candy cane and yellow star on velvet - Christmas Tree
Macro detail of enamel Christmas sweater brooch with candy canes on festive green background - Christmas Sweater
Macro shot of an enamel Christmas brooch with red berries on a striped base with snow - Christmas Gifts
Macro detail of Christmas hat enamel pin with vibrant red and green festive colors - Christmas Hat
+23
Alloy Christmas Brooch Pin Santa Claus Reindeer Snowman Christmas Tree Enamel Badges Holiday Party Decoration Jewelry Gift For Women
-9%
$0.28-1.36
No MOQ
Free Shipping
Christmas Gift Box Paper Candy Packaging Bag Ribbon Tag Santa Snowman Reindeer Design Festive Party Favors Decorative
Christmas Gift Box Paper Candy Packaging Bag Ribbon Tag Santa Snowman Reindeer Design Festive Party Favors Decorative
like
Find Similar
Flat lay of star-shaped Christmas candy gift boxes with festive reindeer and Santa prints - 8Pcs Star Shaped Boxes
Three geometric Christmas gift boxes in red, green, and blue with festive ribbon handles - 12Pcs Geometric Ball Boxes
Detail view of 6 Kraft paper Christmas gift bags with various holiday cutout tags - 24Pcs Snowflake Kraft Bags
6-pack Christmas kraft paper gift bags with snowflake patterns and assorted laser-cut cards - 24Pcs New Snowflake Paper Bags
+4
Christmas Gift Box Paper Candy Packaging Bag Ribbon Tag Santa Snowman Reindeer Design Festive Party Favors Decorative
$1.15-4.90
No MOQ
Christmas Cushion Cover Polyester Linen Texture Retro Oil Painting Style Santa Snowman Printed Pillowcase Sofa Decor
Christmas Cushion Cover Polyester Linen Texture Retro Oil Painting Style Santa Snowman Printed Pillowcase Sofa Decor
like
Find Similar
Vintage Santa Claus pillow cover with wooden lantern and snowy pine needles - Vintage Santa With Lantern (JYM518-1)
Christmas pillowcase featuring artistic snowmen and red bird illustration on linen texture - Snowman And Red Socks (JYM518-2)
Realistic snowman Christmas pillow case with red hat and snow-covered trees design - Forest Snowman (JYM518-3)
Vintage Christmas pillowcase with Santa Claus and wreath print on linen fabric - Santa In Red Robe (JYM518-4)
+12
NewChristmas Cushion Cover Polyester Linen Texture Retro Oil Painting Style Santa Snowman Printed Pillowcase Sofa Decor
$1.15
Mix MOQ : 2
Christmas Cushion Cover Peach Skin Polyester Cartoon Santa Snowman Reindeer Print Decorative Pillowcase Sofa Home Decor
Christmas Cushion Cover Peach Skin Polyester Cartoon Santa Snowman Reindeer Print Decorative Pillowcase Sofa Home Decor
like
Find Similar
Green Christmas peach skin pillowcase with snowflake and gift patterns for home decor - Dark Blue Snowflake Gift Box Style (TPR415-1)
Navy blue Christmas pillowcase with Santa, snowman, and gingerbread man patterns - Dark Blue Santa Snowman Gingerbread Man Style (TPR415-2)
Navy blue Merry Christmas pillowcase with Santa, Mrs. Claus, and elves on white background - Dark Blue Santa Claus and Elves Style (TPR415-3)
Deep blue Christmas cushion cover with snowman and kid illustration on white background - Dark Blue Snowman and Children Style (TPR415-4)
+12
Christmas Cushion Cover Peach Skin Polyester Cartoon Santa Snowman Reindeer Print Decorative Pillowcase Sofa Home Decor
$1.15
Mix MOQ : 2
LED Christmas String Lights Plastic Warm Lighting Holiday Party Home Decor Santa Snowman Reindeer Bell Shape Festive
LED Christmas String Lights Plastic Warm Lighting Holiday Party Home Decor Santa Snowman Reindeer Bell Shape Festive
like
Find Similar
LED snowman string lights with warm glow for festive Christmas home decor on wooden background - Snowman / Warm Light (3m 20-LED Battery Box)
LED Christmas string lights with Santa Claus pendants and warm yellow festive glow - Santa Head / Warm Light (3m 20-LED Battery Box)
Warm LED Christmas reindeer string lights with red bows on a cozy winter backdrop - Elk / Warm Light (3m 20-LED Battery Box)
LED Christmas light string featuring warm yellow glowing snowflake glove ornaments - Gloves / Warm Light (3m 20-LED Battery Box)
+12
LED Christmas String Lights Plastic Warm Lighting Holiday Party Home Decor Santa Snowman Reindeer Bell Shape Festive
$3.40-4.76
No MOQ
LED Christmas Window Hanging Light Acrylic 3D Warm White Suction Cup Holiday Party Decoration Reindeer Snowman Pattern
LED Christmas Window Hanging Light Acrylic 3D Warm White Suction Cup Holiday Party Decoration Reindeer Snowman Pattern
like
Find Similar
Warm white LED acrylic reindeer Christmas light with snowflake pattern and hanging ring - 16CM Snowflake Style
3D acrylic LED Christmas reindeer hanging light in warm white glow, size 25x25cm - 24CM Merry Christmas Style A
Large snowflake shaped warm LED hanging light for Christmas window decoration - 24CM Snowflake Style
Circular LED Christmas hanging light featuring snowman design with warm yellow glow - 24CM Snowman Style
+12
LED Christmas Window Hanging Light Acrylic 3D Warm White Suction Cup Holiday Party Decoration Reindeer Snowman Pattern
$10.92-14.09
No MOQ
Christmas Door Wall Stickers DIY Glitter Felt Snowman Santa Reindeer Party Decoration Window Decals Holiday Ornament
Christmas Door Wall Stickers DIY Glitter Felt Snowman Santa Reindeer Party Decoration Window Decals Holiday Ornament
like
Find Similar
DIY Christmas snowman door decoration kit with glitter felt hat scarf and glue dots - Christmas Snowman Style
Christmas DIY felt kit with Santa beard and red glitter hat for wall window decoration - Santa Claus
Christmas reindeer felt wall sticker set with glitter antlers and eyes for home decor - Reindeer Head
Christmas reindeer horn wall stickers set with brown glitter antlers and red nose decal - Large Reindeer Antlers
+12
Christmas Door Wall Stickers DIY Glitter Felt Snowman Santa Reindeer Party Decoration Window Decals Holiday Ornament
$1.18-1.32
No MOQ
Free Shipping
Christmas Socks Women Coral Fleece Thickened Warm Floor Fuzzy Indoor Home Santa Reindeer Snowman Cartoon Gift
Christmas Socks Women Coral Fleece Thickened Warm Floor Fuzzy Indoor Home Santa Reindeer Snowman Cartoon Gift
like
Find Similar
Cosy coral fleece Christmas socks featuring a snowman design with a black hat and yellow scarf - One Size / Button Snowman
Cozy red Christmas coral fleece socks with cute 3D reindeer pattern for winter warmth - One Size / Scarf Reindeer
Winter thermal coral fleece Christmas socks featuring a festive red snowman design - One Size / Red Scarf Snowman
Christmas coral fleece socks featuring festive green tree patterns on a warm red base - One Size / Christmas Candy Cane
+12
Christmas Socks Women Coral Fleece Thickened Warm Floor Fuzzy Indoor Home Santa Reindeer Snowman Cartoon Gift
$1.33
No MOQ
 · 
10 sold recently
Christmas Headbands Plush Cartoon Santa Snowman Reindeer Antlers Party Decorations For Kids Adults Holiday Costume Accessory
Christmas Headbands Plush Cartoon Santa Snowman Reindeer Antlers Party Decorations For Kids Adults Holiday Costume Accessory
like
Find Similar
Detail of Christmas snowman headband with red hat and striped bow on wooden background - G4-2 Luminous Raising Hands Snowman
Top view of a plush Christmas headband featuring dual snowmen with red hats on wood surface - G3-1 Double Luminous Snowman
Close-up of festive Christmas headband with plush Santa Claus and snowflake decorations - G3-1 Double Luminous Santa Claus
Luminous Santa Claus headband for Christmas parties with red velvet and snowflake decor - G4-2 Luminous Raising Hands Santa Claus
+12
Christmas Headbands Plush Cartoon Santa Snowman Reindeer Antlers Party Decorations For Kids Adults Holiday Costume Accessory
-5%
$0.49-0.90
No MOQ
Christmas Ceramic Figurine LED Light Up Snowman Tree Car Desktop Decor White Glazed Warm Glow Elegant Holiday Ornament
Christmas Ceramic Figurine LED Light Up Snowman Tree Car Desktop Decor White Glazed Warm Glow Elegant Holiday Ornament
like
Find Similar
Ceramic vintage Christmas car decoration with tree, white glaze finish, 16.5cm length - Classic Car with Christmas Tree
White ceramic mini Christmas tree lamp with golden star and built-in battery - Crooked Christmas Tree
Miniature white ceramic glowing house decoration with warm light and dimensions - Small Tile House
Luminous white ceramic Christmas tree decor with internal LED light and battery base - Five-layer Christmas Tree
+2
Christmas Ceramic Figurine LED Light Up Snowman Tree Car Desktop Decor White Glazed Warm Glow Elegant Holiday Ornament
$5.99-10.03
No MOQ
 · 
10 views
Free Shipping
Women Christmas Polyester Bucket Hat Santa Claus Snowman Printed Festive Basin Hat For Holiday Outdoor Sun Protection
Women Christmas Polyester Bucket Hat Santa Claus Snowman Printed Festive Basin Hat For Holiday Outdoor Sun Protection
like
Find Similar
Detailed pattern of festive Santa Claus, snowman and snowflake prints on black bucket hat - M (56-58cm) / Black Christmas Print
Close-up of red Christmas bucket hat with Santa Claus, snowman and snowflake pattern - M (56-58cm) / Red Christmas Print
Close-up of blue festive bucket hat featuring colorful Santa Claus and snowflake prints - M (56-58cm) / Light Blue Christmas Print
Christmas bucket hat with festive Santa Claus and snowflake prints on vibrant red fabric - M (56-58cm) / 1# (Red Green Snowman Tree)
+27
Women Christmas Polyester Bucket Hat Santa Claus Snowman Printed Festive Basin Hat For Holiday Outdoor Sun Protection
$2.16-2.45
Mix MOQ : 2
Christmas Window Clings Static Stickers Double Sided PVC Santa Claus Snowman Reindeer Snowflake Decals Holiday Decor
Christmas Window Clings Static Stickers Double Sided PVC Santa Claus Snowman Reindeer Snowflake Decals Holiday Decor
like
Find Similar
Christmas window stickers featuring Santa, snowman, elk and teddy bear in a festive night scene - Set of 4 (Santa/Snowman/Deer/Bear)
White Christmas window static stickers set with Santa Claus and snowman motifs - Set of 4 (White Christmas Tree/Snowman/Angel/Ornaments)
Christmas static window stickers set featuring Santa, reindeer and Merry Christmas text - Set of 4 (Santa/Reindeer/Wreath/Gifts)
Christmas window decals set featuring cartoon Santa, elk, and snowman on glass pane - Set of 4 (Snowman/Christmas Tree/Reindeer/Greeting)
+23
Christmas Window Clings Static Stickers Double Sided PVC Santa Claus Snowman Reindeer Snowflake Decals Holiday Decor
$0.86-2.16
Mix MOQ : 2
Christmas Table Runner Polyester Jacquard Santa Reindeer Snowman Pattern With Tassels For Holiday Party Dining Decor
Christmas Table Runner Polyester Jacquard Santa Reindeer Snowman Pattern With Tassels For Holiday Party Dining Decor
like
Find Similar
Christmas table runner with Santa Claus and reindeer patterns featuring red and cream tassels - 35*140cm / Santa Claus + Red Tassel
Red Christmas knit table runner with white reindeer and snowflake patterns - 35*140cm / Reindeer + Red Tassel
Blue Christmas table runner with snowman and reindeer patterns and red tassel trim - 35*140cm / Snowman Blue + Red Tassel
Beige Christmas table runner with red tassels and snowman festive patterns - 35*140cm / Snowman White + Red Tassel
+36
Christmas Table Runner Polyester Jacquard Santa Reindeer Snowman Pattern With Tassels For Holiday Party Dining Decor
-5%
$7.67-17.80
No MOQ
Christmas Window Clings PVC Static Stickers Double Sided Cartoon Santa Snowman Reindeer For Glass Showcase Decor
Christmas Window Clings PVC Static Stickers Double Sided Cartoon Santa Snowman Reindeer For Glass Showcase Decor
like
Find Similar
Christmas reindeer and snowman window sticker set with New Year icons and dimensions - BQ280
Christmas reindeer glass window sticker variant BQ282 with snowflake and gift patterns - BQ282
Christmas window sticker set with gingerbread man and candy cane festive patterns - BQ287
Christmas glass sticker set with Santa Claus and Reindeer, 20x30cm festive window decals - BQ276
+13
Christmas Window Clings PVC Static Stickers Double Sided Cartoon Santa Snowman Reindeer For Glass Showcase Decor
$0.35-2.77
Mix MOQ : 2
 · 
12 views
Christmas Cushion Cover Short Plush Soft Reindeer Snowman Pattern Sofa Home Decor Invisible Zipper Festive Pillowcase
Christmas Cushion Cover Short Plush Soft Reindeer Snowman Pattern Sofa Home Decor Invisible Zipper Festive Pillowcase
like
Find Similar
Christmas pillow cover with reindeer and snowflake pattern on a cozy grey sofa - TQR73-1 Red White Reindeer Snowflake
Christmas pillowcase featuring a cartoon Santa Claus face on a bright red background - TQR73-2 Red Cartoon Santa Claus
Christmas pillow cover with white reindeer silhouette on red and black plaid pattern - TQR73-3 Red Black Gingham White Deer Head
Dark green Christmas pillowcase with snowman and penguin on a grey sofa - TQR73-4 Dark Green Cartoon Holiday Mix
+7
Christmas Cushion Cover Short Plush Soft Reindeer Snowman Pattern Sofa Home Decor Invisible Zipper Festive Pillowcase
$1.30
Mix MOQ : 2
Christmas Brooch Pin Enamel Alloy Rhinestone Cartoon Santa Snowman Reindeer Tree Holiday Party Decoration Jewelry Gift
Christmas Brooch Pin Enamel Alloy Rhinestone Cartoon Santa Snowman Reindeer Tree Holiday Party Decoration Jewelry Gift
like
Find Similar
Mini Christmas tree brooch with white enamel, rhinestones and golden alloy finish - Style 1
Mini Christmas tree brooch with green enamel and red rhinestones on a gold alloy base - Style 2
Christmas wreath brooch with green enamel, red heart crystals, and golden stars - Style 5
Miniature Christmas candy cane pins with red and green bows in festive holiday style - Style 6
+24
Christmas Brooch Pin Enamel Alloy Rhinestone Cartoon Santa Snowman Reindeer Tree Holiday Party Decoration Jewelry Gift
-9%
$0.37
Mix MOQ : 10
 · 
13 views
Christmas Tree Hanging Ornament Family Snowman With Pet Dog Resin Hand Painted Printed Holiday Home Decor Hanging Pendant
Christmas Tree Hanging Ornament Family Snowman With Pet Dog Resin Hand Painted Printed Holiday Home Decor Hanging Pendant
like
Find Similar
Family of 7 and golden retriever resin Christmas ornament hanging on green pine tree branch - 6 Snowmen And Pet Dog Hand-painted Style (A328)
DIY Christmas tree resin hanging with family figures and Golden Retriever on tree - 2 Snowmen And Pet Dog Hand-painted Style (A328)
DIY Resin Christmas tree ornament with three person heads, golden retriever, and red ribbon - 3 Snowmen And Pet Dog Hand-painted Style (A328)
DIY Resin Christmas tree pendant with family of 4 and golden retriever dog ornament - 4 Snowmen And Pet Dog Hand-painted Style (A328)
+6
Christmas Tree Hanging Ornament Family Snowman With Pet Dog Resin Hand Painted Printed Holiday Home Decor Hanging Pendant
$1.24-2.45
Mix MOQ : 5
Christmas Stickers Make A Face Puzzle Cartoon Santa Reindeer Snowman Kids Holiday Activity Party Favor Adhesive Paper
Christmas Stickers Make A Face Puzzle Cartoon Santa Reindeer Snowman Kids Holiday Activity Party Favor Adhesive Paper
like
Find Similar
DIY Christmas stickers featuring snowman Santa and reindeer for festive kids crafts - 6 Sheets/Pack
+7
Christmas Stickers Make A Face Puzzle Cartoon Santa Reindeer Snowman Kids Holiday Activity Party Favor Adhesive Paper
$0.61-288.18
No MOQ
 · 
20 views
Free Shipping
White Glitter Christmas Hanging Ornaments Snowman Snowflake Star Bell Bow Carriage Angel Tower Holiday Tree Home Decor
White Glitter Christmas Hanging Ornaments Snowman Snowflake Star Bell Bow Carriage Angel Tower Holiday Tree Home Decor
like
Find Similar
Sparkly white JOY letter ornament with glitter for Christmas tree decoration - JOY Sign
Glittering white star Christmas tree ornament measuring 13cm and weighing 20.5g - Bursting Star
Sparkling white glitter bow ornament for Christmas trees with 9cm hanging ribbon - Bow
White double Christmas bell ornament with silver glitter coating and hanging ribbon - Bell
+8
White Glitter Christmas Hanging Ornaments Snowman Snowflake Star Bell Bow Carriage Angel Tower Holiday Tree Home Decor
$0.66-1.96
Mix MOQ : 2
Free Shipping
Christmas Standing Doll Ornament Knitted Plush Retractable Telescoping Legs Santa Snowman Reindeer Holiday Home Decor
Christmas Standing Doll Ornament Knitted Plush Retractable Telescoping Legs Santa Snowman Reindeer Holiday Home Decor
like
Find Similar
Cute retractable Santa Claus plush doll with red knitted hat and golden snowflake sequins - Short-Legged Santa Claus (Approx. 45cm)
Plush Christmas snowman figurine in red knitted sweater and telescopic legs for decor - Short-Legged Snowman (Approx. 45cm)
Standing Christmas reindeer plush doll with red plaid sweater and festive scarf - Short-Legged Reindeer (Approx. 45cm)
Retractable Christmas Santa Claus plush doll with snowflake embroidery and bell hat - Telescopic Santa Claus (Approx. 60cm)
+5
Christmas Standing Doll Ornament Knitted Plush Retractable Telescoping Legs Santa Snowman Reindeer Holiday Home Decor
$6.46-18.73
No MOQ
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access