Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Hair Clips Kids Girls Glitter Bowknot Reindeer Santa Claus Gingerbread Man Snowman Leather Felt Headwear Hairpins
Christmas Hair Clips Kids Girls Glitter Bowknot Reindeer Santa Claus Gingerbread Man Snowman Leather Felt Headwear Hairpins
like
Find Similar
Cute Christmas reindeer hair clip for kids featuring brown leather bow and antlers - Cute Reindeer
Kids Santa Claus hair clip made of white PU leather with red embroidery and ribbon - Santa Claus
Brown faux leather gingerbread man hair clip with red bow and white embroidery detail - Christmas Gingerbread Man
Kids red faux leather Christmas bow hair clip with mini sequin Santa hat decoration - Christmas Hat Red Bow
+3
Christmas Hair Clips Kids Girls Glitter Bowknot Reindeer Santa Claus Gingerbread Man Snowman Leather Felt Headwear Hairpins
$0.57-5.99
No MOQ
 · 
17 sold recently
Free Shipping
Christmas Party Tableware Plates Cups Knives Forks Spoons Disposable Paper Plastic Snowman Santa Patterns Decorative Festive
Christmas Party Tableware Plates Cups Knives Forks Spoons Disposable Paper Plastic Snowman Santa Patterns Decorative Festive
like
Find Similar
Set of 10 Christmas snowman paper plates with Merry Christmas greeting 7.01in diameter - 7 Inch Christmas Snowman Paper Plates 10PCS
Set of 10 Christmas paper plates with Santa and Snowman design, 8.97 inch diameter - 9 Inch Christmas Snowman Paper Plates 10PCS
Set of 10 red Christmas paper cups featuring snowmen with specific dimensions and patterns - Christmas Snowman Paper Cups 10PCS
Fan-shaped arrangement of 10 red plastic knives for Christmas party tableware set - Red Plastic Dinner Knives 10PCS
+3
Christmas Party Tableware Plates Cups Knives Forks Spoons Disposable Paper Plastic Snowman Santa Patterns Decorative Festive
-5%
$0.49-2.05
Mix MOQ : 5
 · 
10 views
Christmas Snowman Faux Fur Pompom Keychain Cute PU Leather Snowman Bag Charm Pendant Festive Holiday Gift For Women
Christmas Snowman Faux Fur Pompom Keychain Cute PU Leather Snowman Bag Charm Pendant Festive Holiday Gift For Women
like
Find Similar
Christmas snowman keychain with white faux fur pompom and gold metal clasp on white background - White
Detail of plush Christmas snowman keychain with red faux fur pompom and golden metal ring - Red
Christmas snowman faux fur pompom keychain with green hat and gold-plated metal ring - Mint Green
Detail of a plush snowman charm with a pink faux fur pompom and golden keyring - Rose Red
+22
Christmas Snowman Faux Fur Pompom Keychain Cute PU Leather Snowman Bag Charm Pendant Festive Holiday Gift For Women
$0.68
No MOQ
Snowman Christmas Wreath LED Light Rattan Pine Needle Pine Cone Buffalo Plaid Bow For Front Door Wall Home Holiday Decor
Snowman Christmas Wreath LED Light Rattan Pine Needle Pine Cone Buffalo Plaid Bow For Front Door Wall Home Holiday Decor
like
Find Similar
Snowman Christmas wreath with red bow and LED lights on white woven rattan base - Black and Red Plaid
Christmas snowman rattan wreath with warm LED lights and pine needle decor for home - Black and White Plaid
Snowman Christmas Wreath LED Light Rattan Pine Needle Pine Cone Buffalo Plaid Bow For Front Door Wall Home Holiday Decor
$4.76
No MOQ
 · 
21 views
Christmas Silicone Molds For DIY Candle Soap Making 3D Snowman Reindeer Bell Shapes Fondant Baking Tool Food Grade Soft
Christmas Silicone Molds For DIY Candle Soap Making 3D Snowman Reindeer Bell Shapes Fondant Baking Tool Food Grade Soft
like
Find Similar
Melting snowman silicone candle mold for DIY Christmas crafts, 8.5cm diameter size - Melting Snowman / 80g
Silicone snowman candle mold with a 13cm height for DIY Christmas aromatherapy soap - Snowman / 180g
Standing reindeer silicone mold for DIY Christmas candles and handmade soap making - Deer / 216g
Christmas bell silicone candle mold for handmade soap crafts with Merry Christmas text - Bell 135g
+1
Christmas Silicone Molds For DIY Candle Soap Making 3D Snowman Reindeer Bell Shapes Fondant Baking Tool Food Grade Soft
-5%
$1.37-3.42
No MOQ
 · 
11 views
Christmas Window Clings Double Sided PVC Static Stickers Snowflakes Christmas Tree Snowman Decals Home Glass Decoration
Christmas Window Clings Double Sided PVC Static Stickers Snowflakes Christmas Tree Snowman Decals Home Glass Decoration
like
Find Similar
Size chart for blue Christmas static window stickers with tree and snowflake dimensions - BQ535 Style
Blue Christmas bird window stickers with snowflakes and Merry Christmas lettering - BQ536 Style
Size chart for colorful Christmas tree window stickers measuring 30cm by 20cm - BQ545 Style
Christmas tree and snowman static window stickers set with detailed size dimensions - BQ546 Style
+13
Christmas Window Clings Double Sided PVC Static Stickers Snowflakes Christmas Tree Snowman Decals Home Glass Decoration
$0.26-2.42
Mix MOQ : 2
Creative Christmas Cartoon Gel Pens Silicone 3D Santa Snowman Reindeer Tree Decoration Stationery Black Ink Signature Pens Gift
Creative Christmas Cartoon Gel Pens Silicone 3D Santa Snowman Reindeer Tree Decoration Stationery Black Ink Signature Pens Gift
like
Find Similar
Christmas theme gel pen set featuring 5 pieces with 3D silicone Reindeer and Snowman toppers - Christmas Mixed Style (Type B)
Christmas neutral pen set with reindeer and pine tree toppers for festive stationery gift - 0.5mm / Style C 3D Christmas Gel Pen
Set of 4 Christmas cartoon ballpoint pens featuring Santa and reindeer silicone toppers - Classic Christmas Elements Style (Type A)
Set of 4 Christmas gel pens with Santa, reindeer, tree, and gift box toppers - 0.5mm / E-style Christmas-themed 3d Gel Pen
+3
Creative Christmas Cartoon Gel Pens Silicone 3D Santa Snowman Reindeer Tree Decoration Stationery Black Ink Signature Pens Gift
$0.11
No MOQ
Christmas Snowman Doll Ornament Plush Fabric Golden Pattern Festive Desktop Decoration Holiday Home Gift Nordic Style
Christmas Snowman Doll Ornament Plush Fabric Golden Pattern Festive Desktop Decoration Holiday Home Gift Nordic Style
like
Find Similar
Plush Christmas snowman doll with beige knitted hat and gold branches, 26cm height - 26cm Round Hat Snowman / YH20017B
Plush Christmas snowman doll with pointed knit hat and golden branch patterns, 50cm tall - 50cm Pointed Hat Snowman / YH20016A
Plush Christmas snowman doll with khaki knit hat and gold scarf, 35cm tall decoration - 35cm Round Hat Snowman / YH20016B
60cm plush snowman figurine in beige and gold with detailed holiday branch patterns - 60cm Pointed Hat Snowman / YH20015A
+2
Christmas Snowman Doll Ornament Plush Fabric Golden Pattern Festive Desktop Decoration Holiday Home Gift Nordic Style
-5%
$5.20-8.49
Mix MOQ : 2
 · 
20 views
Christmas Snow Globe Lantern LED Lighted Water Filled Glitter Sparkle Santa Snowman Decorative Holiday Home Decor Desk Ornament Gift
Christmas Snow Globe Lantern LED Lighted Water Filled Glitter Sparkle Santa Snowman Decorative Holiday Home Decor Desk Ornament Gift
like
Find Similar
Detail of Christmas tree water lantern with Santa inside on a vintage book - Christmas Tree Shape/Water Injection / Christmas Tree Red Santa
Close-up of a white Christmas tree lantern with a snowman and glitter inside the LED core - Christmas Tree Shape/Water Injection / Christmas Tree White Snowman
Macro detail of Christmas tree light with golden base and swirling glitter effect - Christmas Tree Shape/Water Injection / Christmas Tree Green Children
Detail of red Christmas lantern featuring Santa scene with LED glittering candle light - Electronic Candle Shape/Water Injection / Candle Style Santa
+22
Christmas Snow Globe Lantern LED Lighted Water Filled Glitter Sparkle Santa Snowman Decorative Holiday Home Decor Desk Ornament Gift
$2.16-7.20
No MOQ
Christmas Charm Bracelet Acrylic Resin Link Chain Alloy Enamel Pendants Snowman Reindeer Bell Holiday Jewelry Adjustable
Christmas Charm Bracelet Acrylic Resin Link Chain Alloy Enamel Pendants Snowman Reindeer Bell Holiday Jewelry Adjustable
like
Find Similar
Christmas chain bracelet with red, green, white links and Merry Christmas tag - Merry Christmas Tag
Christmas bracelet with red green resin links, gold chain and snowman charm on wrist - Snowman
Christmas charm bracelet with red green chain and Santa Claus pendant on model wrist - Santa Claus
Christmas chain bracelet with red, green and white links and a gold reindeer charm - Elk
+22
Christmas Charm Bracelet Acrylic Resin Link Chain Alloy Enamel Pendants Snowman Reindeer Bell Holiday Jewelry Adjustable
-5%
$0.87-1.20
No MOQ
Free Shipping
LED Christmas Hat Plush Glowing Santa Claus Snowman Reindeer For Kids Adults Holiday Party Decor Novelty
LED Christmas Hat Plush Glowing Santa Claus Snowman Reindeer For Kids Adults Holiday Party Decor Novelty
like
Find Similar
Detailed view of red Christmas hat with plush Santa appliqué and colorful snowflakes - Kids Non-Glowing-Santa Claus
Detailed view of red plush Christmas hat featuring glowing snowman and snowflake accents - Kids Non-Glowing-Snowman
Close-up of red light-up Christmas hat with plush reindeer applique and sequin snowflakes - Kids Non-Glowing-Reindeer
Close-up of soft plush red Christmas hat with white faux fur trim and festive decor - Short Plush-Kids
+12
LED Christmas Hat Plush Glowing Santa Claus Snowman Reindeer For Kids Adults Holiday Party Decor Novelty
$0.45-1.44
No MOQ
 · 
13 views
Christmas Decorative Throw Pillow Case Linen Cotton Winter Holiday Square Cushion Cover Snowman Reindeer Plaid Home Decor
Christmas Decorative Throw Pillow Case Linen Cotton Winter Holiday Square Cushion Cover Snowman Reindeer Plaid Home Decor
like
Find Similar
Detail of Christmas gingerbread man linen pillowcase on a sofa, festive holiday home decor - Cartoon Gingerbread Man (21)
Christmas linen pillowcase with black and gold holiday patterns on a grey sofa - Merry Gold Black White Collage (22)
Linen Christmas pillow case featuring Noel letters and reindeer in vintage collage style - Noel Vintage Collage (23)
Christmas linen pillow cover featuring a cartoon snowman with Let It Snow text design - Let It Snow Snowman (20)
+19
Christmas Decorative Throw Pillow Case Linen Cotton Winter Holiday Square Cushion Cover Snowman Reindeer Plaid Home Decor
-4%
$1.18
No MOQ
Christmas Hair Clips Fabric Alloy Snowman Santa Tree Cute Cartoon Holiday Party Decoration Accessories For Kids Girls
Christmas Hair Clips Fabric Alloy Snowman Santa Tree Cute Cartoon Holiday Party Decoration Accessories For Kids Girls
like
Find Similar
Christmas hair clips set of five with red bows and green pom-poms for girls - Style 6 Christmas Cherry 5Pcs Set
Five-piece Christmas themed hair clip set for girls featuring sequins and pom-poms - Style 5 Christmas Star 5Pcs Set
5-piece Christmas hair clip set for kids with Santa, hat, and bow on display card - Style 4 Christmas Hat 5Pcs Set
5-piece Christmas hair clip set for girls with festive bows, stars, and snowman motifs - Style 3 Christmas Bowknot 5Pcs Set
+2
Christmas Hair Clips Fabric Alloy Snowman Santa Tree Cute Cartoon Holiday Party Decoration Accessories For Kids Girls
$0.86
No MOQ
 · 
70 sold recently
Women Christmas Coral Fleece Sleeping Socks Thick Warm Winter Home Floor Hosiery Cartoon Reindeer Snowman Pattern
Women Christmas Coral Fleece Sleeping Socks Thick Warm Winter Home Floor Hosiery Cartoon Reindeer Snowman Pattern
like
Find Similar
Winter snowman themed white coral fleece socks with blue cuff and red scarf pattern - One Size / Blue White Snowman
Thick red coral fleece Christmas socks featuring a 3D Santa Claus face and buttons - One Size / Santa Claus
Thick coral fleece Christmas socks in yellow with cartoon reindeer and red stars - One Size / Yellow Elk
Thick navy blue coral fleece socks with cute penguin pattern and warm fuzzy texture - One Size / Penguin
+2
Women Christmas Coral Fleece Sleeping Socks Thick Warm Winter Home Floor Hosiery Cartoon Reindeer Snowman Pattern
$1.15
Mix MOQ : 2
Christmas Cartoon Brooch Pins Alloy Enamel Santa Reindeer Snowman Tree Holiday Clothing Decoration Accessories Gift For Women
Christmas Cartoon Brooch Pins Alloy Enamel Santa Reindeer Snowman Tree Holiday Clothing Decoration Accessories Gift For Women
like
Find Similar
Cute enamel Santa Claus brooch pin with red and white festive colors on card - Santa Claus
Cute Christmas polar bear enamel pin with red hat and scarf on a display card - Snowman
Cute brown cartoon reindeer brooch with red scarf on display card for accessories - Elk
Cute white polar bear enamel pin with a red scarf on a brand display card - Christmas Bear
+2
Christmas Cartoon Brooch Pins Alloy Enamel Santa Reindeer Snowman Tree Holiday Clothing Decoration Accessories Gift For Women
-9%
$0.39
Mix MOQ : 5
 · 
286 sold recently
Christmas Window Stickers Static Clings PVC Reindeer Santa Snowman Cartoon Festival Home Decor Shop Display Double Sided
Christmas Window Stickers Static Clings PVC Reindeer Santa Snowman Cartoon Festival Home Decor Shop Display Double Sided
like
Find Similar
Christmas wall stickers set with Santa and Merry Christmas text in 55x90cm size - AMJ057 Large Santa Claus & Gifts
Detail view of Christmas wall stickers showing sheet layout and final wall application sizes - AMJ056 Large Santa Claus Balloon
Christmas wall decal dimensions featuring Santa Claus on hot air balloon with snowflakes - AMJ044 Christmas Hot Air Balloon
Detailed dimension guide for Christmas window stickers with Santa and snowman patterns - AMJ046 Santa Claus in Chimney
+26
Christmas Window Stickers Static Clings PVC Reindeer Santa Snowman Cartoon Festival Home Decor Shop Display Double Sided
-5%
$1.23-5.07
Mix MOQ : 2
Christmas Enamel Alloy Brooch Pin Set Cartoon Santa Claus Snowman Christmas Tree Bell Reindeer Lapel Badge Festive Jewelry For Party Gift
Christmas Enamel Alloy Brooch Pin Set Cartoon Santa Claus Snowman Christmas Tree Bell Reindeer Lapel Badge Festive Jewelry For Party Gift
like
Find Similar
Christmas wreath brooch pin with festive red ribbons and green holly leaves design - Christmas Wreath (4871)
Christmas Santa Claus brooch pin with red enamel and sparkling rhinestones on gold metal - Santa Claus Head (4872)
Christmas bell brooch pin with red berries and pearl detail on a white background - Christmas Bell (7544)
Enamel Christmas tree brooch with colorful beads and star on green velvet background - Christmas Tree (6066)
+11
Christmas Enamel Alloy Brooch Pin Set Cartoon Santa Claus Snowman Christmas Tree Bell Reindeer Lapel Badge Festive Jewelry For Party Gift
-15%
$0.28-0.54
No MOQ
Christmas Table Runner Jacquard Red White Reindeer Snowman Santa Claus Tassels Holiday Dining Room Table Decoration
Christmas Table Runner Jacquard Red White Reindeer Snowman Santa Claus Tassels Holiday Dining Room Table Decoration
like
Find Similar
Red Christmas knit table runner with white reindeer and snowflake patterns - 35*140cm / Reindeer + Red Tassel
Beige Christmas table runner with red tassels and snowman festive patterns - 35*140cm / Snowman White + Red Tassel
Blue Christmas table runner with snowman and reindeer patterns and red tassel trim - 35*140cm / Snowman Blue + Red Tassel
Christmas table runner with Santa Claus and reindeer patterns featuring red and cream tassels - 35*140cm / Santa Claus + Red Tassel
+40
Christmas Table Runner Jacquard Red White Reindeer Snowman Santa Claus Tassels Holiday Dining Room Table Decoration
-5%
$5.48-17.80
No MOQ
Christmas Cartoon Erasable Cardboard Whiteboard With Marker Pen And Lanyard Santa Snowman Holiday Message Board
Christmas Cartoon Erasable Cardboard Whiteboard With Marker Pen And Lanyard Santa Snowman Holiday Message Board
like
Find Similar
Christmas snowman whiteboard stationery set with dry-erase pen and hanging lanyard - Snowman
Christmas penguin memo board set with marker and lanyard for holiday gift - Christmas Penguin
Christmas reindeer whiteboard stationery set with purple dry-erase marker and festive lanyard - Christmas Reindeer Blue
Christmas bear doodle whiteboard set with red marker and hanging rope for kids - Christmas Bear
+1
Christmas Cartoon Erasable Cardboard Whiteboard With Marker Pen And Lanyard Santa Snowman Holiday Message Board
$0.52
No MOQ
 · 
55 sold recently
Christmas Throw Pillow Case Peach Skin Decorative Cushion Cover Reindeer Snowman Letter Print Sofa Pillowcase For Home Decor
Christmas Throw Pillow Case Peach Skin Decorative Cushion Cover Reindeer Snowman Letter Print Sofa Pillowcase For Home Decor
like
Find Similar
Christmas pillowcase featuring cartoon snowman and dog with gift boxes design - Cartoon Snowman and Gift Box (TPR305-1)
White Christmas pillowcase with Merry Christmas text and festive cartoon gingerbread icons - Christmas Tree and Gingerbread Man (TPR305-2)
Merry Christmas throw pillow cover with minimalist black trees and artistic typography - Simple Christmas Tree and Geometric (TPR305-3)
Christmas cushion cover with Merry Christmas text and festive cartoon Corgi dog print - Corgi Dog with Santa Hat (TPR305-4)
+20
Christmas Throw Pillow Case Peach Skin Decorative Cushion Cover Reindeer Snowman Letter Print Sofa Pillowcase For Home Decor
-4%
$1.10
Mix MOQ : 2
Led Glowing Christmas Headband Plush Santa Snowman Reindeer Holiday Party Headwear Cute Cartoon Costume Decor
Led Glowing Christmas Headband Plush Santa Snowman Reindeer Holiday Party Headwear Cute Cartoon Costume Decor
like
Find Similar
LED Christmas headband with dual Santa Claus figures and colorful glowing lights - S2-5 LED Santa Claus Double Headband
LED Christmas headband with glowing snowman design on a velvet band for party decoration - S2-6 LED Snowman Double Headband
Christmas LED headband featuring white reindeer motifs and cozy red plush for festive parties - S2-7 LED Reindeer Double Headband
LED Christmas headband with white plush bears and festive red hat on wooden background - S2-8 LED Bear Double Headband
+11
Led Glowing Christmas Headband Plush Santa Snowman Reindeer Holiday Party Headwear Cute Cartoon Costume Decor
$1.10-1.38
No MOQ
Christmas Hair Clips Cute Reindeer Antlers Santa Snowman Festive Plush Resin Metal Hairpins For Kids Girls Party Decor
Christmas Hair Clips Cute Reindeer Antlers Santa Snowman Festive Plush Resin Metal Hairpins For Kids Girls Party Decor
like
Find Similar
Detail of orange plush reindeer antler hair clips with cute cartoon deer resin patches - 1 Pair Reindeer Deer Design
Detail view of festive reindeer antler hair clips with snowman and fuzzy brown ears - 1 Pair Snowman Design
Detail of Christmas reindeer antler hair clips with plush leaves and gift box ornaments - 1 Pair Gift Box Design
Detailed view of reindeer antler hair clips with miniature Christmas trees on faux snow - 1 Pair Christmas Tree Design
+11
Christmas Hair Clips Cute Reindeer Antlers Santa Snowman Festive Plush Resin Metal Hairpins For Kids Girls Party Decor
-5%
$0.71-1.23
Mix MOQ : 2
Free Shipping
Christmas Charms Pendants Zinc Alloy Enamel Santa Claus Reindeer Snowman Bell Tree House For DIY Jewelry Making
Christmas Charms Pendants Zinc Alloy Enamel Santa Claus Reindeer Snowman Bell Tree House For DIY Jewelry Making
like
Find Similar
Detail of 18mm gold reindeer charm with red enamel for DIY Christmas jewelry making - 2 Brown Reindeer
Detail of red knit hat charms with dimensions 18mm by 16mm for DIY jewelry making - 3 Red Christmas Hat
Detailed view of 19mm yellow enamel Christmas bell charms with snowflakes and dimensions - 5 Yellow Bell
Detailed front and back view of a 19mm green enamel snowflake Christmas bell pendant - 6 Green Bell
+11
Christmas Charms Pendants Zinc Alloy Enamel Santa Claus Reindeer Snowman Bell Tree House For DIY Jewelry Making
$0.12-0.14
No MOQ
 · 
12 views
Free Shipping
Christmas Stake Lights Outdoor Solar LED Star Snowflake Santa Snowman Shape Waterproof Garden Path Decorative Neon Lighting
Christmas Stake Lights Outdoor Solar LED Star Snowflake Santa Snowman Shape Waterproof Garden Path Decorative Neon Lighting
like
Find Similar
10 options
Christmas Stake Lights Outdoor Solar LED Star Snowflake Santa Snowman Shape Waterproof Garden Path Decorative Neon Lighting
$5.19-6.05
Mix MOQ : 20
Christmas Satin Ribbon Gold Stamped Merry Christmas Snowflake Snowman Patterns Holiday Gift Wrapping Party Decoration
Christmas Satin Ribbon Gold Stamped Merry Christmas Snowflake Snowman Patterns Holiday Gift Wrapping Party Decoration
like
Find Similar
Golden satin Christmas ribbon with snowflake and tree patterns for gift wrapping, 25 yards - 2.5cmx25 Yards / Gold Snowman Style (G-3)
25-yard dark green satin ribbon with gold snowflake and Christmas tree prints - 2.5cmx25 Yards / Dark Green Snowman Style (G-1)
Red Christmas satin ribbon 25 yards with gold foil reindeer and snowflake patterns - 2.5cmx25 Yards / Wine Red Dotted Gift Style (G-24)
25 Yards Red Satin Christmas Ribbon with Gold Snowflake and Reindeer G-2 Print - 2.5cmx25 Yards / Red Snowman Style (G-2)
+6
Christmas Satin Ribbon Gold Stamped Merry Christmas Snowflake Snowman Patterns Holiday Gift Wrapping Party Decoration
$4.61
Mix MOQ : 10
Christmas Snowman Polar Bear Figurines Flocked Foam Ornaments Plaid Fabric Winter Desktop Holiday Decoration Festive Gift
Christmas Snowman Polar Bear Figurines Flocked Foam Ornaments Plaid Fabric Winter Desktop Holiday Decoration Festive Gift
like
Find Similar
Christmas snowman decoration with red and green plaid hat and warm white flocking - 23x10cm / Snowman with Christmas Hat
White flocked polar bear figurine with red and green knit scarf for Christmas decoration - 14.5x11cm / Sitting Bear
White flocked polar bear ornament with red bells and striped bow for Christmas tree - 7.5x11cm / Bell Bear
20cm white flocked snowman doll with plaid scarf and hat for Christmas decoration - 20x15cm / Scarf Snowman
+6
Christmas Snowman Polar Bear Figurines Flocked Foam Ornaments Plaid Fabric Winter Desktop Holiday Decoration Festive Gift
-5%
$2.68-26.78
No MOQ
Free Shipping
Christmas Mid-Calf Socks Knitted Cotton Blend Cartoon Santa Claus Elk Snowman Holiday Party Gift Dimensional Ears Pom-Poms
Christmas Mid-Calf Socks Knitted Cotton Blend Cartoon Santa Claus Elk Snowman Holiday Party Gift Dimensional Ears Pom-Poms
like
Find Similar
Red Christmas cotton socks featuring green Christmas tree patterns and white snowflakes - One Size / Red Christmas Tree with 3D Ears
Christmas cotton socks with 3D pom-poms and cute Santa Claus holding a gift in black - One Size / Black Santa Claus with Pom-pom
Festive red Christmas socks with Santa Claus pattern and 3D ears for women - One Size / Green Santa Claus with Pom-pom
Red Christmas cotton socks featuring reindeer patterns and cute hanging pom-poms - One Size / Red Reindeer with Pom-pom
+6
Christmas Mid-Calf Socks Knitted Cotton Blend Cartoon Santa Claus Elk Snowman Holiday Party Gift Dimensional Ears Pom-Poms
$0.68
Mix MOQ : 3
Handmade Wool Felt Christmas Ball Ornaments Hanging Tree Decoration Snowflake Snowman Gingerbread Man Festive Home Decor
Handmade Wool Felt Christmas Ball Ornaments Hanging Tree Decoration Snowflake Snowman Gingerbread Man Festive Home Decor
like
Find Similar
Set of 6 red wool felt Christmas ball ornaments with snowflake patterns, 5cm diameter - Style A 6Pcs Red Series
Set of 6 handmade wool felt Christmas balls with gold snowflake embroidery in a kraft box - Style C 6Pcs Mixed Color Snowflakes
Set of 6 red wool felt Christmas balls with snowman and snowflake designs, 5cm size - Style D 6Pcs Red Snowman Series
Set of 6 red wool felt Christmas balls with white patterns in a kraft gift box - Style G 6Pcs Red Embroidery Pattern
+6
Handmade Wool Felt Christmas Ball Ornaments Hanging Tree Decoration Snowflake Snowman Gingerbread Man Festive Home Decor
-4%
$6.52-8.98
No MOQ
Free Shipping
Christmas Hair Clips Cartoon Santa Snowman Reindeer Tree Stocking Acrylic Alloy Festive Party Accessories Gifts
Christmas Hair Clips Cartoon Santa Snowman Reindeer Tree Stocking Acrylic Alloy Festive Party Accessories Gifts
like
Find Similar
Cute Santa Claus Christmas hair clip accessory, red and white design, size 5x4cm - Santa Claus (AFTS4-1)
Cute red Christmas sock hair clip with pink bow and happy lettering embroidery - Christmas Stocking (AFTS4-2)
Cute Christmas snowman hair clip made of glossy resin, 3x5cm festive hair accessory - Snowman (AFTS4-4)
Cute green Christmas tree hair clip with red bow and colorful polka dots, 5cm height - Green Christmas Tree (AFTS4-5)
+6
Christmas Hair Clips Cartoon Santa Snowman Reindeer Tree Stocking Acrylic Alloy Festive Party Accessories Gifts
-4%
$1.37
No MOQ
Free Shipping
Christmas Tree Ornaments Hanging Pendants Painted Resin Vintage 3D Snowman Snowflake Star Heart Decoration
Christmas Tree Ornaments Hanging Pendants Painted Resin Vintage 3D Snowman Snowflake Star Heart Decoration
like
Find Similar
Green resin Christmas tree ornament with red dots and white snow detail 6.5cm - Christmas Tree
Hand-painted snowman resin ornament with red scarf and top hat for Christmas tree decor - Snowman
White snowflake resin Christmas ornament with gold trim 6cm diameter 20g hanging decoration - Snowflake Style
Vintage resin rocking horse Christmas ornament with red base hanging on a tree - Rocking Horse Style
+3
Christmas Tree Ornaments Hanging Pendants Painted Resin Vintage 3D Snowman Snowflake Star Heart Decoration
$1.41
No MOQ
 · 
197 sold recently
Christmas Wooden House Miniature Village Desktop Ornaments Snow Covered Scene With Mini Trees Snowman Rustic Xmas Decor
Christmas Wooden House Miniature Village Desktop Ornaments Snow Covered Scene With Mini Trees Snowman Rustic Xmas Decor
like
Find Similar
Wooden Christmas scene featuring a white snow house and a red truck on a timber base - White Snow Roof House with Red Truck and Pine Cone (WH24-5132-A)
Christmas wooden snow house ornaments with green tree on base, 20cm height - Red and White Houses with Green Tree (WH24-5132-B)
Christmas wooden house ornament with snowman and mini tree on snowy base for desktop decor - Red House with Snowman and Ladder (WH24-5129-A)
Christmas wooden red house with snow-covered pine trees on a rectangular base - Red House with Triple Christmas Trees (WH24-5129-B)
+2
Christmas Wooden House Miniature Village Desktop Ornaments Snow Covered Scene With Mini Trees Snowman Rustic Xmas Decor
-5%
$6.79-9.86
No MOQ
Christmas Telephone Booth Lantern LED Glowing Water Globe Ornament Retro Desktop Decoration With Snowman Santa Figures
Christmas Telephone Booth Lantern LED Glowing Water Globe Ornament Retro Desktop Decoration With Snowman Santa Figures
like
Find Similar
Vintage bronze telephone booth snow globe featuring a white angel and warm glitter lighting - Bronze Angel (No Water)
+6
Christmas Telephone Booth Lantern LED Glowing Water Globe Ornament Retro Desktop Decoration With Snowman Santa Figures
$2.45-3.17
Mix MOQ : 2
Christmas Hanging Ornaments Felt Santa Claus Reindeer Snowman Star For Xmas Tree Decor Festive Holiday Party
Christmas Hanging Ornaments Felt Santa Claus Reindeer Snowman Star For Xmas Tree Decor Festive Holiday Party
like
Find Similar
Red plush star Christmas ornament with colorful pom-poms and gold Merry Christmas text - Star Ornament
Christmas snowman tree ornament in red and white fabric with festive gold hanging string - Bow Snowman Ornament
Plush Christmas reindeer ornament with red nose and green bow, height 13.3cm size guide - Bow Reindeer Ornament
Detail view of plush Santa pendant with dimensions 13.8cm height for Xmas tree decoration - Santa Claus Pendant
+3
Christmas Hanging Ornaments Felt Santa Claus Reindeer Snowman Star For Xmas Tree Decor Festive Holiday Party
$0.18-0.87
No MOQ
 · 
75 sold recently
Christmas Santa Sack Large Canvas Linen Drawstring Gift Bag For Holiday Present Storage Reindeer Snowman Print Design
Christmas Santa Sack Large Canvas Linen Drawstring Gift Bag For Holiday Present Storage Reindeer Snowman Print Design
like
Find Similar
Large burlap Christmas gift bag with drawstrings measuring 66x48cm for holiday presents - Style 1-Holly Jolly Christmas Text
Red and black buffalo plaid Christmas drawstring gift bag with North Pole mail print - Style 2-North Pole Mail Plaid Patchwork
Large Christmas drawstring gift bag with a cute snowman print and 48x66cm dimensions - Style 4-Cartoon Snowman
Christmas reindeer drawstring gift bag in linen style fabric, size 48x66cm large sack - Style 3-Cartoon Reindeer
Christmas Santa Sack Large Canvas Linen Drawstring Gift Bag For Holiday Present Storage Reindeer Snowman Print Design
-4%
$2.96
Mix MOQ : 3
 · 
177 sold recently
Cartoon Christmas Peach Skin Decorative Throw Pillow Cover Santa Claus Reindeer Snowman Pattern Festive Home Sofa Cushion Case
Cartoon Christmas Peach Skin Decorative Throw Pillow Cover Santa Claus Reindeer Snowman Pattern Festive Home Sofa Cushion Case
like
Find Similar
White Christmas pillow cover with red and black buffalo plaid Merry Christmas wreath - Wreath And Merry Christmas (TPR303-1) / 45x45CM (No Core)
White Christmas pillow cover with red and black buffalo plaid tree and Merry Christmas text - Plaid Christmas Tree (TPR303-2) / 45x45CM (No Core)
White Christmas pillowcase featuring red and black plaid Oh Deer reindeer design - Antler OH DEER (TPR303-3) / 45x45CM (No Core)
Christmas pillow cover with Merry and Bright typography in red buffalo plaid design - Red Black Art Font Merry Bright (TPR303-4) / 45x45CM (No Core)
+36
Cartoon Christmas Peach Skin Decorative Throw Pillow Cover Santa Claus Reindeer Snowman Pattern Festive Home Sofa Cushion Case
-4%
$1.10
Mix MOQ : 2
Christmas Ribbon Faux Burlap Printed Snowman Vintage Truck Pattern Wired Edge For Gift Wrapping Tree Decor Festive
Christmas Ribbon Faux Burlap Printed Snowman Vintage Truck Pattern Wired Edge For Gift Wrapping Tree Decor Festive
like
Find Similar
Beige Christmas ribbon featuring a red vintage truck and Merry Christmas print - 2m Christmas Cream Car Ribbon (5cm Wide)
Red linen-textured Christmas ribbon with vintage truck and tree prints for gift wrapping - 2m Christmas Red Car Ribbon (5cm Wide)
Linen Christmas ribbon with red truck and tree patterns with golden glitter edges - 5m Christmas Khaki Car Ribbon (5cm Wide)
Light gray linen Christmas ribbon with gold glitter car and tree prints for decoration - 10m Christmas Grey Car Ribbon (5cm Wide)
+21
Christmas Ribbon Faux Burlap Printed Snowman Vintage Truck Pattern Wired Edge For Gift Wrapping Tree Decor Festive
$0.86-3.46
Mix MOQ : 2
Christmas Curtains Polyester Semi-Shading Holiday Window Drapes Santa Reindeer Snowman Print For Living Room Bedroom
Christmas Curtains Polyester Semi-Shading Holiday Window Drapes Santa Reindeer Snowman Print For Living Room Bedroom
like
Find Similar
Detail of Christmas curtain featuring Santa Claus and reindeer on red and blue fabric - 140x100cm / Blue Santa Claus Print (Pair)
Detail of red Christmas curtain with Santa Claus print and Merry Christmas text - 140x100cm / Red Christmas Snowflakes (Pair)
Detail of Christmas snowman curtains with festive red prints and Merry Christmas text - 140x100cm / Red Christmas Snowman (Pair)
Detail of Christmas themed dark blue curtains featuring Santa Claus and reindeer prints - 140x100cm / Blue Christmas Gift (Pair)
+21
Christmas Curtains Polyester Semi-Shading Holiday Window Drapes Santa Reindeer Snowman Print For Living Room Bedroom
$4.84-7.87
No MOQ
Christmas Snowman Floor Mat Non-slip Absorbent Flannel Rug For Bathroom Kitchen Entrance Holiday Home Decor Polyester
Christmas Snowman Floor Mat Non-slip Absorbent Flannel Rug For Bathroom Kitchen Entrance Holiday Home Decor Polyester
like
Find Similar
Christmas flannel mat featuring a snowman and cabin print on a tiled floor - 40x60cm / Style 1-Snowman & Cabin
Christmas flannel doormat featuring a cozy winter cabin night snow scene for home decor - 40x60cm / Style 2-Winter Night Cabin
Christmas flannel absorbent doormat with winter cabin scene and non-slip backing - 40x60cm / Style 3-Euro Snowy View
Detail of winter cabin scene printed on flannel absorbent doormat on dark wood floor - 40x60cm / Style 4-Artistic Snowy View
+21
Christmas Snowman Floor Mat Non-slip Absorbent Flannel Rug For Bathroom Kitchen Entrance Holiday Home Decor Polyester
$3.46-10.95
No MOQ
Christmas Wall Hanging Tapestry Polyester Fabric Merry Christmas Snowman Reindeer Winter Home Decor Bedroom Background Cloth
Christmas Wall Hanging Tapestry Polyester Fabric Merry Christmas Snowman Reindeer Winter Home Decor Bedroom Background Cloth
like
Find Similar
Christmas snowman tapestry with glowing lanterns and gift boxes for dorm wall decoration - 150x130cm / Snowman Lantern
Creative knitted wall clock with red Roman numerals for cozy Christmas wall decor - 150x130cm / Knitted Clock
Christmas wall tapestry with rustic lantern and pine cones on wood background decor - 150x130cm / Winter Lantern Star
Christmas tapestry with wood grain pattern and Merry Christmas text on bedroom wall - 150x130cm / Wood Grain Reindeer
+21
Christmas Wall Hanging Tapestry Polyester Fabric Merry Christmas Snowman Reindeer Winter Home Decor Bedroom Background Cloth
$4.03-10.09
No MOQ
Christmas Plush Dolls Santa Claus Snowman Reindeer Sequin Fabric Telescopic Long Legs Holiday Home Decoration Ornament
Christmas Plush Dolls Santa Claus Snowman Reindeer Sequin Fabric Telescopic Long Legs Holiday Home Decoration Ornament
like
Find Similar
25 options
Christmas Plush Dolls Santa Claus Snowman Reindeer Sequin Fabric Telescopic Long Legs Holiday Home Decoration Ornament
$7.20
Mix MOQ : 2
Kids Christmas Socks Cotton Mid Calf With 3D Plush Santa Snowman Reindeer For Toddler Holiday Winter
Kids Christmas Socks Cotton Mid Calf With 3D Plush Santa Snowman Reindeer For Toddler Holiday Winter
like
Find Similar
Detail of coffee brown ribbed knit sock featuring a 3D plush reindeer with golden antlers - XS (0-1 Years) / Khaki - Bell Reindeer
Detail view of red knitted Christmas stocking socks featuring a plush Santa Claus figure - XS (0-1 Years) / Red - Squinting Santa
Close-up of green knitted children socks with festive plush Christmas tree decoration - XS (0-1 Years) / Green - Star Christmas Tree
Close-up of a white ribbed cotton sock with a cute 3D plush snowman and red hat detail - XS (0-1 Years) / White - Scarf Snowman
+21
Kids Christmas Socks Cotton Mid Calf With 3D Plush Santa Snowman Reindeer For Toddler Holiday Winter
$2.28
Mix MOQ : 3
Free Shipping
Christmas Banner Bunting Garland Paper Hanging Decoration Santa Claus Snowman Xmas Tree Party Decor Holiday Ornaments
Christmas Banner Bunting Garland Paper Hanging Decoration Santa Claus Snowman Xmas Tree Party Decor Holiday Ornaments
like
Find Similar
Christmas bunting banner with 8 Santa and Snowman cards, adjustable 3m rope length decor - Santa Claus & Snowman Banner
Christmas tree paper banner with 8 green and white flags and 3-meter red adjustable cord - Christmas Tree Banner
Christmas banner featuring cartoon Santa Claus and reindeer icons with 3m adjustable rope - Santa Claus & Reindeer Banner
Christmas stocking banner with 8 red and green patterned pieces on 3m adjustable rope - Christmas Stocking Banner
+21
Christmas Banner Bunting Garland Paper Hanging Decoration Santa Claus Snowman Xmas Tree Party Decor Holiday Ornaments
$0.63
Mix MOQ : 2
Girls Christmas Long Sleeve A-Line Dress Kids Snowman Elf Striped Digital Print Autumn Festive Clothing For Toddlers
Girls Christmas Long Sleeve A-Line Dress Kids Snowman Elf Striped Digital Print Autumn Festive Clothing For Toddlers
like
Find Similar
Girls snowman Christmas dress with red scarf and 3D carrot nose on white fabric - 2XL / White Snowman Style (B487-1005)
Kids long sleeve Christmas dress with elf theme stripes and snowman print for girls - S / Red & White Elf Style (B487-1006)
Kids Christmas elf dress with green and white stripes and holiday themed print - S / Green & White Elf Style (B487-1007)
Girl's long-sleeve Christmas dress with cat, candy cane, and tree festive prints - S / Christmas Cat Style (B487-1008)
+21
Girls Christmas Long Sleeve A-Line Dress Kids Snowman Elf Striped Digital Print Autumn Festive Clothing For Toddlers
$8.36
No MOQ
Christmas Iron Art Ornaments Metal Pendants Santa Claus Snowman Reindeer Hand Painted Festive Home Decor Hanging Decor
Christmas Iron Art Ornaments Metal Pendants Santa Claus Snowman Reindeer Hand Painted Festive Home Decor Hanging Decor
like
Find Similar
Hand-painted metal Santa Claus hanging ornament with red finish and white star patterns - Red Santa Claus Hanging Ornament
Green metal reindeer Christmas ornament with red scarf and gold bell, 12cm height - Green Reindeer Hanging Ornament
Christmas snowman hanging ornament with red hat and snowflake wand for holiday decor - White Snowman Hanging Ornament
Hand-painted Santa Claus metal ornament with red spherical body and rustic hanging twine - Red Fat Santa Hanging Ornament
+4
Christmas Iron Art Ornaments Metal Pendants Santa Claus Snowman Reindeer Hand Painted Festive Home Decor Hanging Decor
$3.11-4.84
No MOQ
Free Shipping
Christmas LED Lantern Triangle Pyramid Hanging Lamp Warm Glow ABS Festive Ornament Retro White Santa Snowman Reindeer Decor
Christmas LED Lantern Triangle Pyramid Hanging Lamp Warm Glow ABS Festive Ornament Retro White Santa Snowman Reindeer Decor
like
Find Similar
White pyramid Christmas lantern with Santa Claus pattern and warm LED light hanging ring - Santa Claus / White
White pyramid Christmas lantern with snowman illustration and warm LED light effect - Snowman / White
White triangular Christmas LED lantern with silver ring and Merry Christmas tree motif - Christmas Tree / White
White triangle Christmas lantern with reindeer print and warm LED light effect - Elk / White
+4
Christmas LED Lantern Triangle Pyramid Hanging Lamp Warm Glow ABS Festive Ornament Retro White Santa Snowman Reindeer Decor
$1.30-1.38
Mix MOQ : 2
 · 
17 views
Christmas Beaded Bracelet Polymer Clay Alloy Santa Snowman Reindeer Charms Festive Handcrafted Holiday Jewelry Accessories For Women
Christmas Beaded Bracelet Polymer Clay Alloy Santa Snowman Reindeer Charms Festive Handcrafted Holiday Jewelry Accessories For Women
like
Find Similar
Detail of Christmas beaded bracelet set with snowflake and reindeer charms on display card - SY0668-Christmas Element 4PCS Set
Christmas beaded bracelet set with reindeer, tree, and Santa charms on display card - SY0669-Christmas Reindeer 4PCS Set
Detailed view of 4-piece Christmas bracelet set with Santa and tree charms on a festive card - SY0670-Santa and Tree 4PCS Set
Close-up of four-piece Christmas beaded bracelet set with snowman and hat charms - SY0671-Snowman and Gift 4PCS Set
+4
Christmas Beaded Bracelet Polymer Clay Alloy Santa Snowman Reindeer Charms Festive Handcrafted Holiday Jewelry Accessories For Women
$1.62-5.09
Mix MOQ : 2
Free Shipping
Christmas LED Lantern Retro Handheld Night Light Ornament Hanging Decoration Plastic Glass Santa Snowman Pattern Warm Glow
Christmas LED Lantern Retro Handheld Night Light Ornament Hanging Decoration Plastic Glass Santa Snowman Pattern Warm Glow
like
Find Similar
White LED Christmas lantern with snowman scene and warm light for festive decoration - White-Snowman
White house-shaped Christmas lantern with warm LED light and Santa Claus illustration - White-Santa Claus
Ivory Christmas lantern with Santa sleigh print and warm LED candle inside - White-Elk
White vintage Christmas LED lantern with snowman and reindeer patterns and warm light - White-Christmas Tree
+4
Christmas LED Lantern Retro Handheld Night Light Ornament Hanging Decoration Plastic Glass Santa Snowman Pattern Warm Glow
$1.79-1.93
Mix MOQ : 2
 · 
10 views
Christmas Crew Socks Cotton Spandex Blend Breathable Festive Pattern Santa Claus Reindeer Snowman Novelty Casual Holiday Unisex Adults
Christmas Crew Socks Cotton Spandex Blend Breathable Festive Pattern Santa Claus Reindeer Snowman Novelty Casual Holiday Unisex Adults
like
Find Similar
Festive mid-calf Christmas socks with Santa and Reindeer asymmetric holiday patterns - 1109/Black Red Mismatched/Santa with Sunglasses
Green Christmas crew socks with red accents and festive Santa Claus scooter pattern - 1110/Green/Santa on Scooter
Christmas socks set featuring festive gnomes and holiday light patterns on gray and red - 1111/Red Grey Mismatched/Christmas Gnomes and Lights
Christmas socks featuring masked Santa Claus and reindeer designs in red and black - 1112/Brown Black Mismatched/Masked Santa Claus
+4
Christmas Crew Socks Cotton Spandex Blend Breathable Festive Pattern Santa Claus Reindeer Snowman Novelty Casual Holiday Unisex Adults
$1.15
Mix MOQ : 10
Christmas Bow Hair Clips For Girls Grosgrain Ribbon Santa Snowman Alligator Clips Xmas Holiday Hair Accessories
Christmas Bow Hair Clips For Girls Grosgrain Ribbon Santa Snowman Alligator Clips Xmas Holiday Hair Accessories
like
Find Similar
Detail of red Christmas ribbon bow clip with green snowflake pattern and center ornament - Red Green Snowflake Style
Christmas ribbon hair bow in green fabric with white snowflakes and red dots for kids - Green Snowflake Style
Close-up of green Christmas ribbon hair bow with glitter tree charm and star patterns - Green Christmas Tree Style
Red ribbon Christmas hair clip with green tree pattern and glitter ornament - Red Christmas Tree Style
+4
Christmas Bow Hair Clips For Girls Grosgrain Ribbon Santa Snowman Alligator Clips Xmas Holiday Hair Accessories
$0.33-0.45
No MOQ
 · 
20 sold recently
Free Shipping
Christmas Kids Hair Accessories Red Elastic Hair Ties Resin Santa Claus Snowman Reindeer Hair Clips For Girls Party Decoration
Christmas Kids Hair Accessories Red Elastic Hair Ties Resin Santa Claus Snowman Reindeer Hair Clips For Girls Party Decoration
like
Find Similar
Close-up of a red elastic hair tie with a resin Santa Claus decoration for Christmas - Santa Hat Hair Tie
Close-up of a festive Christmas Santa Claus charm on a red elastic hair tie for kids - Santa Claus Hair Tie
Detail of red elastic hair tie with a festive Christmas hat and star decoration - Christmas Hat Hair Tie
Close-up of a red elastic hair tie featuring a festive Christmas stocking and candy cane - Christmas Boot Hair Tie
+14
Christmas Kids Hair Accessories Red Elastic Hair Ties Resin Santa Claus Snowman Reindeer Hair Clips For Girls Party Decoration
-12%
$0.07-0.10
Mix MOQ : 10
Christmas Woven Bracelet Alloy Enamel Santa Snowman Charms Magnetic Handshake Couples Friends Wish Bracelet Gift
Christmas Woven Bracelet Alloy Enamel Santa Snowman Charms Magnetic Handshake Couples Friends Wish Bracelet Gift
like
Find Similar
Christmas polymer clay bracelet with Santa pendant on kraft card in festive holiday setting - D1178 (Santa Soft Clay Style)
Christmas wish bracelet with red green polymer clay beads and Santa Claus charm on card - D1168 (Santa Head Soft Clay Style)
Christmas clay bead bracelet on kraft card with Santa Claus and snowflake pendants - D1166 (Snowman Soft Clay Style)
Detailed view of Christmas candy cane bracelet with polymer clay beads and a wish card - D1169 (Candy Cane Soft Clay Style)
+18
Christmas Woven Bracelet Alloy Enamel Santa Snowman Charms Magnetic Handshake Couples Friends Wish Bracelet Gift
-5%
$0.32-7.10
No MOQ
Christmas Stockings Hanging Gift Bags 3D Cartoon Santa Snowman Reindeer Burlap Plush Fireplace Decor Holiday Ornament
Christmas Stockings Hanging Gift Bags 3D Cartoon Santa Snowman Reindeer Burlap Plush Fireplace Decor Holiday Ornament
like
Find Similar
Christmas stocking with red green plaid fabric and 3D plush reindeer decoration - Mini Plush Reindeer Style / Mini
Christmas stocking with grey reindeer design and red plaid cuff for holiday decor - Mini Linen Reindeer Style / Mini
Plaid Christmas stocking with snowman decor and faux fur cuff, size 16x13cm - Mini Plush Snowman Style / Mini
Red and black plaid Christmas stocking with 3D Santa Claus figure and faux fur trim decoration - Mini Plush Santa Style / Mini
+18
Christmas Stockings Hanging Gift Bags 3D Cartoon Santa Snowman Reindeer Burlap Plush Fireplace Decor Holiday Ornament
-5%
$0.69-4.80
No MOQ
Christmas Wine Glass Charms Set Enamel Snowman Santa Claus Wine Glass Identifiers With Faux Artificial Pearls Beads For Holiday Party Home Bar Table Decoration
Christmas Wine Glass Charms Set Enamel Snowman Santa Claus Wine Glass Identifiers With Faux Artificial Pearls Beads For Holiday Party Home Bar Table Decoration
like
Find Similar
Golden round hoop earrings with alternating blue and white pearls on white background - Blue And White Pearl Style (Z1312-1-BLU)
Golden hoop ring with red and white pearl charms for Christmas wine glass decor - Red And White Pearl Style (Z1312-1-RE)
Golden hoop wine glass charm with gradient white and champagne pearls for Christmas - Champagne And White Pearl Style (Z1312-1-BR)
Golden wine glass charm ring with green beads and white pearls for Christmas party decor - Green And White Pearl Style (Z1312-1-GR)
+31
Christmas Wine Glass Charms Set Enamel Snowman Santa Claus Wine Glass Identifiers With Faux Artificial Pearls Beads For Holiday Party Home Bar Table Decoration
$0.23-0.49
No MOQ
LED Light Up Christmas Headband Feather Antlers Santa Claus Snowman Star Festive Party Hair Accessory Holiday Decoration
LED Light Up Christmas Headband Feather Antlers Santa Claus Snowman Star Festive Party Hair Accessory Holiday Decoration
like
Find Similar
Christmas LED headband with red plaid reindeer antlers and white feathers decoration - Christmas Red Antlers
Light-up Christmas headband with red base, white feathers and golden double stars - Red Gold Five-Pointed Star
LED Christmas headband with red sequin antlers, white feathers, and size specifications - Red Reindeer Horns
Light-up brown reindeer antler headband with colorful bells and glowing LED feathers - Brown Antlers With Bells
+26
LED Light Up Christmas Headband Feather Antlers Santa Claus Snowman Star Festive Party Hair Accessory Holiday Decoration
-3%
$1.09-1.28
Mix MOQ : 2
Double Sided Linen Christmas Garden Flag Snowman Reindeer Winter Holiday Outdoor Yard Decoration Xmas Hanging Sign Banner
Double Sided Linen Christmas Garden Flag Snowman Reindeer Winter Holiday Outdoor Yard Decoration Xmas Hanging Sign Banner
like
Find Similar
Christmas garden flag with snowman and red cardinal bird on green linen fabric - 30x45cm / Snowman Holding Golden Bell Style (1)
Double-sided linen garden flag featuring a winter chickadee and festive red bow - 30x45cm / Chickadee and Christmas Wreath Style (2)
Double-sided linen Christmas garden flag featuring watercolor reindeers and HELLO Winter text - 30x45cm / Winter Reindeer and Cardinal Style (3)
Nativity scene silhouette Christmas garden flag with Merry Christmas text on metal stand - 30x45cm / Nativity Scene Silhouette Style (4)
+19
Double Sided Linen Christmas Garden Flag Snowman Reindeer Winter Holiday Outdoor Yard Decoration Xmas Hanging Sign Banner
$1.15
Mix MOQ : 2
Christmas Keychain Alloy Enamel Gold Metal Hanging Ornament Holiday Tree Snowman Wreath Charm Festive Gift Novelty
Christmas Keychain Alloy Enamel Gold Metal Hanging Ornament Holiday Tree Snowman Wreath Charm Festive Gift Novelty
like
Find Similar
Golden Christmas tree keychain with colorful enamel holiday charms on a white tray - Christmas Tree - Style 1
Golden Christmas keychain with green enamel rhinestone tree and festive wreath pendant - Christmas Tree - Style 3
Christmas tree and snowman metal keychain with gold clasp on white background - Christmas Tree - Style 4
Christmas keychain with golden finish featuring enamel green tree and white snowman charms - Christmas Tree - Style 5
+1
Christmas Keychain Alloy Enamel Gold Metal Hanging Ornament Holiday Tree Snowman Wreath Charm Festive Gift Novelty
-9%
$0.38
No MOQ
 · 
98 sold recently
Christmas Tree Hanging Ornaments Plush Fabric Santa Snowman Reindeer Bear Dolls For Holiday Home Party Decoration Gift
Christmas Tree Hanging Ornaments Plush Fabric Santa Snowman Reindeer Bear Dolls For Holiday Home Party Decoration Gift
like
Find Similar
Classic plush Santa Claus Christmas tree ornament with red burlap and white fur trim - Santa Claus
Detailed view of plush snowman ornament with red plaid fabric hanging on a snowy branch - Snowman
Christmas reindeer plush ornament with brown fur, red felt details and festive scarf - Elk
Christmas bear plush pendant with red plaid hat and green holly berry patterns - Bear
Christmas Tree Hanging Ornaments Plush Fabric Santa Snowman Reindeer Bear Dolls For Holiday Home Party Decoration Gift
$0.52
Mix MOQ : 2
Christmas Cartoon Snowman Reindeer Tinsel Headband For Kids Adults Party Decoration Snowflake Xmas Hat Hair Hoop Accessories
Christmas Cartoon Snowman Reindeer Tinsel Headband For Kids Adults Party Decoration Snowflake Xmas Hat Hair Hoop Accessories
like
Find Similar
Detailed view of Christmas reindeer headband with size 24.1cm by 23.3cm dimensions - Gift Box Elk Style
Detailed view of Christmas headband with snowman and reindeer dimensions 25.3x23.5cm - Snowman Elk Style
Detail view of a Christmas headband with green glitter stars and festive holly berry accents - Bell Star Style
Christmas headband with gold reindeer and green glitter tree on a red base - Elk Sleigh Style
+20
Christmas Cartoon Snowman Reindeer Tinsel Headband For Kids Adults Party Decoration Snowflake Xmas Hat Hair Hoop Accessories
$0.77-1.31
Mix MOQ : 2
Christmas Santa Claus Snowman Reindeer Plush Dolls Knitted Fabric Holiday Ornaments Indoor Decoration Soft Handcrafted Home
Christmas Santa Claus Snowman Reindeer Plush Dolls Knitted Fabric Holiday Ornaments Indoor Decoration Soft Handcrafted Home
like
Find Similar
Large 76cm retractable red and white knitted Christmas reindeer plush doll ornament - Red White Knitted Reindeer Retractable (76cm)
Standing 45cm Santa Claus plush toy with red knit outfit and snowflake patterned hat - Red White Knitted Santa Standing (45cm)
50cm plush Christmas snowman doll in red and white knit outfit for holiday decoration - Red White Knitted Snowman Sitting Large (50cm)
Red knitted Santa Claus plush doll with snowflake hat and wooden button, 30cm height - Red White Knitted Santa Sitting Small (30cm)
+6
Christmas Santa Claus Snowman Reindeer Plush Dolls Knitted Fabric Holiday Ornaments Indoor Decoration Soft Handcrafted Home
$5.76-11.53
Mix MOQ : 2
Christmas Hair Clips Cloth Metal Plush Glitter Reindeer Snowman Santa Claus Holiday Party Hair Accessories For Girls Kids
Christmas Hair Clips Cloth Metal Plush Glitter Reindeer Snowman Santa Claus Holiday Party Hair Accessories For Girls Kids
like
Find Similar
Detailed view of Christmas hair clips with plush Santa hat and glitter ribbon on a card - Style 2
Detailed view of 5-piece Christmas hair clips including reindeer, hat, and sequined tree - Style 1
Detail view of 5-piece Christmas hair clip set with plush snowman and reindeer bow - Style 9
Close-up of 5-piece Christmas hair clips set featuring reindeer and bowknot on card - Style 3
+6
Christmas Hair Clips Cloth Metal Plush Glitter Reindeer Snowman Santa Claus Holiday Party Hair Accessories For Girls Kids
$0.94-1.41
Mix MOQ : 2
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access