Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
925 Sterling Silver Christmas Charms Beads For DIY Bracelet Snowman Santa Claus Enamel Zirconia Pendant Festive Holiday Jewelry Gift
925 Sterling Silver Christmas Charms Beads For DIY Bracelet Snowman Santa Claus Enamel Zirconia Pendant Festive Holiday Jewelry Gift
like
Find Similar
S925 sterling silver lucky cat charm bead with red enamel and lucky symbols - 925 Silver/Enamel / Christmas Lucky Cat-Red Fortune
925 sterling silver Christmas tree charm with colorful enamel and gold star detail - 925 Silver/Enamel / Christmas Tree-Purple Gradient
925 sterling silver snowman charm with colorful enamel details for holiday bracelets - 925 Silver/Enamel / Christmas Snowman-Red Scarf
Authentic 925 sterling silver Christmas bear charm with red enamel and green gemstones - 925 Silver/Zirconia/Enamel / Christmas Bear-Heart Zirconia
+8
925 Sterling Silver Christmas Charms Beads For DIY Bracelet Snowman Santa Claus Enamel Zirconia Pendant Festive Holiday Jewelry Gift
$16.51-28.29
No MOQ
 · 
21 views
Free Shipping
Melting Snowman Silicone Mold Christmas DIY Baking Tool For Fondant Chocolate Cake Candle Soap Making White
Melting Snowman Silicone Mold Christmas DIY Baking Tool For Fondant Chocolate Cake Candle Soap Making White
like
Find Similar
1 option
Melting Snowman Silicone Mold Christmas DIY Baking Tool For Fondant Chocolate Cake Candle Soap Making White
$1.59
Mix MOQ : 5
 · 
18 views
Vintage Christmas Roll Stickers Round Santa Reindeer Snowman Patterns For Gift Wrapping Envelope Sealing DIY Holiday Decor
Vintage Christmas Roll Stickers Round Santa Reindeer Snowman Patterns For Gift Wrapping Envelope Sealing DIY Holiday Decor
like
Find Similar
Macro view of 12 vintage Christmas sticker designs with Santa, reindeer and snowman prints - ZB93 (500 PCS)
Vintage Christmas Roll Stickers Round Santa Reindeer Snowman Patterns For Gift Wrapping Envelope Sealing DIY Holiday Decor
-5%
$0.33
No MOQ
 · 
20 sold recently
Wooden Christmas Ornaments Gingerbread Man LED Glowing House Snowman Snowflake Hanging Holiday Tree Decoration
Wooden Christmas Ornaments Gingerbread Man LED Glowing House Snowman Snowflake Hanging Holiday Tree Decoration
like
Find Similar
Lighted wooden gingerbread house ornament with LED warm glow for Christmas decor - Light Up Gingerbread House A
Gingerbread style LED wooden house ornament for Christmas tree decor, size 9x6x4.5cm - Light Up Gingerbread House B
Lighted wooden gingerbread house ornament with warm LED and red white hanging string - Light Up Gingerbread House C
Gingerbread man wooden Christmas hanging ornament with tree and gifts, 13.5x10cm size - Gingerbread Sleigh With Lollipop
+20
Wooden Christmas Ornaments Gingerbread Man LED Glowing House Snowman Snowflake Hanging Holiday Tree Decoration
$0.52-2.82
No MOQ
Free Shipping
Christmas Wall Tapestry Santa Claus Snowman Reindeer Polyester Fabric Hanging For Holiday Party Home Decor
Christmas Wall Tapestry Santa Claus Snowman Reindeer Polyester Fabric Hanging For Holiday Party Home Decor
like
Find Similar
Detailed view of red Christmas tapestry with Santa Claus hanging in a modern living room - 95x73cm / Q-Version Santa Carrying Gift Bag Style (Style 1)
Cozy living room detail featuring a red Santa Claus and Christmas tree wall tapestry - 95x73cm / Santa and Xmas Tree Black Red Background Style (Style 2)
Detail of Christmas Santa tapestry hanging over a sofa in a modern living room setting - 95x73cm / Santa Sleigh Reindeer Dark Blue Background Style (Style 3)
Christmas tapestry featuring a cute cartoon reindeer with snowflakes for home holiday wall decor - 95x73cm / Cute Reindeer Giving Thumbs Up Style (Style 4)
+20
Christmas Wall Tapestry Santa Claus Snowman Reindeer Polyester Fabric Hanging For Holiday Party Home Decor
$2.45-6.63
Mix MOQ : 2
Christmas Curtains Polyester Semi Blackout Rod Pocket Printed Santa Reindeer Snowman Xmas Tree Festive Home Decor
Christmas Curtains Polyester Semi Blackout Rod Pocket Printed Santa Reindeer Snowman Xmas Tree Festive Home Decor
like
Find Similar
Detail of red Christmas curtain with Santa Claus print and Merry Christmas text - 140*100 / Red Christmas Snowflake
Detail of Christmas snowman curtains with festive red prints and Merry Christmas text - 140*100 / Red Christmas Snowman
Detail of Christmas themed dark blue curtains featuring Santa Claus and reindeer prints - 140*100 / Blue Christmas Gift
Detail of red plaid Christmas curtain featuring gingerbread and evergreen branch motifs - 140*100 / Red Christmas Plaid
+20
NewChristmas Curtains Polyester Semi Blackout Rod Pocket Printed Santa Reindeer Snowman Xmas Tree Festive Home Decor
-4%
$4.60-7.48
No MOQ
Christmas Curtain Polyester Printed Snowman Snowflake Semi Shading Window Drapes For Living Room Bedroom Holiday Home
Christmas Curtain Polyester Printed Snowman Snowflake Semi Shading Window Drapes For Living Room Bedroom Holiday Home
like
Find Similar
Detail of Christmas snowman curtains with festive red prints and Merry Christmas text - 140*100 / Red Christmas Snowman
Detail of red Christmas curtain with Santa Claus print and Merry Christmas text - 140*100 / Red Christmas Snowflake
Detail of Christmas themed dark blue curtains featuring Santa Claus and reindeer prints - 140*100 / Blue Christmas Gift
Detail of red plaid Christmas curtain featuring gingerbread and evergreen branch motifs - 140*100 / Red Christmas Plaid
+20
Christmas Curtain Polyester Printed Snowman Snowflake Semi Shading Window Drapes For Living Room Bedroom Holiday Home
-4%
$4.60-7.48
No MOQ
Christmas Gift Bags White Cardboard Handheld With Ribbon Handles Santa Snowman Holiday Festival Present Packaging Elegant
Christmas Gift Bags White Cardboard Handheld With Ribbon Handles Santa Snowman Holiday Festival Present Packaging Elegant
like
Find Similar
Black Christmas gift bag with Santa and blue ribbon handle in festive setting - Christmas Tree / Small/Single (18*8.5*24cm)
Christmas gift bag with silver Merry Christmas lettering and silk handle in blue - Christmas Gift / Small/Single (18*8.5*24cm)
Blue Christmas gift bag with Santa Claus and snowman graphic in a snowy scene - Snowman / Small/Single (18*8.5*24cm)
Dark blue Christmas gift bag with golden Merry Christmas stars and festive illustration - Santa Claus / Small/Single (18*8.5*24cm)
+20
Christmas Gift Bags White Cardboard Handheld With Ribbon Handles Santa Snowman Holiday Festival Present Packaging Elegant
$0.49-9.12
Mix MOQ : 5
Mini Christmas Stocking Hanging Ornament Santa Snowman Reindeer Bear Plaid Cloth Felt Sequin Xmas Tree Decor Gift Bag
Mini Christmas Stocking Hanging Ornament Santa Snowman Reindeer Bear Plaid Cloth Felt Sequin Xmas Tree Decor Gift Bag
like
Find Similar
Red Christmas stocking with reindeer plush and plaid trim for holiday tree decoration - Plaid Reindeer / Small
Mini Christmas stocking with 3D reindeer design and sequins hanging on a snowy pine tree - Sequined Reindeer / Small
Christmas stocking candy bag with 3D snowman pattern hanging on a festive Xmas tree - Snowflake Snowman / Small
Red Christmas stocking with snowman motif and Merry Christmas text on white fence - Letter Print Snowman / Small
+20
Mini Christmas Stocking Hanging Ornament Santa Snowman Reindeer Bear Plaid Cloth Felt Sequin Xmas Tree Decor Gift Bag
-5%
$0.52-0.55
Mix MOQ : 2
Christmas Party Decoration Glasses Frames With Glitter Sequin Felt Santa Reindeer Antlers Snowman Festive Photo Props
Christmas Party Decoration Glasses Frames With Glitter Sequin Felt Santa Reindeer Antlers Snowman Festive Photo Props
like
Find Similar
Set of 12 festive Christmas party glasses frames with glitter reindeer and Santa designs - 12-Piece Christmas Glasses Set
Detailed set of 6 festive Christmas eyeglass frames with glitter and holiday motifs - 6-Piece Christmas Glasses Set
Detail showing 6 festive Christmas glasses and 6 plush red Santa hats for party decorations - 6 Christmas Glasses + 6 Christmas Hats
Christmas party set with 6 glasses, 6 headbands, and 6 hats in festive holiday colors - 6 Glasses + 6 Hats + 6 Headbands
+3
Christmas Party Decoration Glasses Frames With Glitter Sequin Felt Santa Reindeer Antlers Snowman Festive Photo Props
$4.03-11.47
Mix MOQ : 2
 · 
21 views
Christmas Brooch Pins Acrylic Alloy Drip Glue Santa Snowman Reindeer Tree Holiday Party Decorative Cartoon Jewelry For Women
Christmas Brooch Pins Acrylic Alloy Drip Glue Santa Snowman Reindeer Tree Holiday Party Decorative Cartoon Jewelry For Women
like
Find Similar
Christmas stud earring set featuring snowman, reindeer, tree, and gift box designs - Set 1 (4 Pieces)
Detailed close-up of acrylic Christmas brooches featuring gingerbread man and Xmas tree - Set 4 (3 Pieces)
Detailed view of three acrylic Christmas brooches featuring Santa, elk, and candy cane - Set 5 (3 Pieces)
Detailed view of three-piece Christmas acrylic pins with snowman and gift box designs - Set 6 (3 Pieces)
+3
Christmas Brooch Pins Acrylic Alloy Drip Glue Santa Snowman Reindeer Tree Holiday Party Decorative Cartoon Jewelry For Women
$0.45-0.79
Mix MOQ : 2
 · 
61 sold recently
Christmas Party Aluminum Foil Balloons With Santa Snowman Reindeer Shapes For Holiday Home Celebration Decoration
Christmas Party Aluminum Foil Balloons With Santa Snowman Reindeer Shapes For Holiday Home Celebration Decoration
like
Find Similar
Christmas balloon set with Santa Claus and Merry Christmas stars for party decoration - Santa Claus and Star Balloons
5-piece Christmas balloon set with Santa tree and star shapes for festive party decor - Christmas Tree and Star Balloons
Christmas party balloon set with Santa Claus stocking, foil stars and Merry Christmas prints - Christmas Stocking and Star Balloons
Festive gingerbread man foil balloon set with Merry Christmas stars and red ribbon - Gingerbread Man and Star Balloons
+5
Christmas Party Aluminum Foil Balloons With Santa Snowman Reindeer Shapes For Holiday Home Celebration Decoration
-5%
$1.45-1.92
No MOQ
Christmas Door Hanger Hanging Decoration Paper DIY Santa Claus Snowman Festive Ornament For Front Door Wall Porch
Christmas Door Hanger Hanging Decoration Paper DIY Santa Claus Snowman Festive Ornament For Front Door Wall Porch
like
Find Similar
Christmas XMAS wall hanging decor with cartoon elephant bear giraffe and rabbit - XMAS Style
Detailed view of Christmas snowman door hanging with dimensions 23cm, 22.2cm and 12.6cm - Snowman
Vertical Christmas door hanging decor with size labels for each holiday element - Christmas Tree
Detailed view of Christmas door hanging with Santa and Reindeer showing 34.6cm width size - Reindeer Santa Claus Style
+2
Christmas Door Hanger Hanging Decoration Paper DIY Santa Claus Snowman Festive Ornament For Front Door Wall Porch
-5%
$0.44-1.12
Mix MOQ : 5
 · 
17 sold recently
Christmas Apron Polyester Cloth Cartoon Santa Snowman Print Kitchen Cooking Restaurant Party Holiday Decoration
Christmas Apron Polyester Cloth Cartoon Santa Snowman Print Kitchen Cooking Restaurant Party Holiday Decoration
like
Find Similar
Christmas apron with red background featuring festive cartoon snowman and reindeer print - Red Snowman and Reindeer Pattern (A款)
Green Christmas apron with red trim featuring a snowman print and Merry Christmas text - Green Big Snowman Pattern (B款)
Christmas apron with gingerbread man and red plaid pattern for holiday parties - Red Plaid Gingerbread Man (C款)
Red plaid Christmas apron with Merry Christmas print hanging on a wooden hanger - Red Plaid Merry Christmas Text (D款)
+2
Christmas Apron Polyester Cloth Cartoon Santa Snowman Print Kitchen Cooking Restaurant Party Holiday Decoration
$1.73
No MOQ
 · 
334 sold recently
Cute Christmas Keychains Resin Santa Snowman Gingerbread Man Charms Holiday Hanging Decorative Ornaments For Backpack
Cute Christmas Keychains Resin Santa Snowman Gingerbread Man Charms Holiday Hanging Decorative Ornaments For Backpack
like
Find Similar
Macro view of cute gingerbread man keychain with red clasp and sugar glaze details - Gingerbread Man
Close-up of a smiling star plush with a red Christmas hat and a metal lobster clasp - Star with Hat
Detail of cute Santa Claus keychain with green metal clasp on festive gift packaging - Santa Claus
Detail of a Christmas stocking keychain with red and white colors and a green bow - Christmas Sock
+2
Cute Christmas Keychains Resin Santa Snowman Gingerbread Man Charms Holiday Hanging Decorative Ornaments For Backpack
-5%
$0.16
Mix MOQ : 2
 · 
54 sold recently
Christmas Charms Alloy Enamel DIY Jewelry Making Accessory Santa Claus Snowman Christmas Tree Reindeer Pendants
Christmas Charms Alloy Enamel DIY Jewelry Making Accessory Santa Claus Snowman Christmas Tree Reindeer Pendants
like
Find Similar
Set of 10 brown enamel reindeer head charms with red Christmas hats for DIY jewelry - Cartoon Reindeer Head Style (1#)
Green enamel Christmas hat charms with rose gold metal edges for DIY jewelry making - Green Snowflake Knit Hat Style (4#)
Detail of ten red and white enamel knit hat charms for DIY jewelry and crafts - Red White Snowflake Knit Hat Style (13#)
Macro view of Christmas bell charms with red bows and green enamel for DIY jewelry - Christmas Bow Bell Style (2#)
+10
Christmas Charms Alloy Enamel DIY Jewelry Making Accessory Santa Claus Snowman Christmas Tree Reindeer Pendants
-5%
$0.72-1.49
Mix MOQ : 2
 · 
22 sold recently
Christmas Wooden Train Ornament Painted Mini Figures Santa Snowman Reindeer Festive Desktop Decoration Nordic Style Gift
Christmas Wooden Train Ornament Painted Mini Figures Santa Snowman Reindeer Festive Desktop Decoration Nordic Style Gift
like
Find Similar
Red and gold wooden Christmas train ornament with snowman and gift box miniatures - 20CM Red and Gold Mini Train
White and gold painted wooden Christmas train with snowman and polar bear figures - 20CM White and Gold Mini Train
Green wooden Christmas train ornament with reindeer and gift box cars, 20cm length - 20CM Multicolor Mini Train
Red and green painted wooden Christmas train ornament with snowmen and bears, 19.8cm long - 20CM Red and Green Mini Train
+4
Christmas Wooden Train Ornament Painted Mini Figures Santa Snowman Reindeer Festive Desktop Decoration Nordic Style Gift
$5.71
No MOQ
Free Shipping
Christmas Snowman Plush Ornaments White Gold Sequin Knit Hat Scarf Tabletop Decoration Winter Holiday Home Decor
Christmas Snowman Plush Ornaments White Gold Sequin Knit Hat Scarf Tabletop Decoration Winter Holiday Home Decor
like
Find Similar
Three-piece snowman plush family with gold knit hats and festive pine needle accents - Round Hat Set of 3
Small snowman plush doll with check scarf and golden antlers for Christmas decor, 25x24cm - Small Round Hat
Christmas snowman plush doll in cream with gold knit hat and scarf, 36cm x 26cm size - Medium Round Hat
Christmas snowman plush doll with brown knit hat and gold pattern details, 42cm height - Large Round Hat
+4
Christmas Snowman Plush Ornaments White Gold Sequin Knit Hat Scarf Tabletop Decoration Winter Holiday Home Decor
-5%
$6.02-26.01
No MOQ
Christmas LED Solar Ground Plug Lights Waterproof Outdoor Garden Path Decoration Tree Snowman Star Snowflake Novelty
Christmas LED Solar Ground Plug Lights Waterproof Outdoor Garden Path Decoration Tree Snowman Star Snowflake Novelty
like
Find Similar
Outdoor solar LED Christmas tree stake lights with red striped candy cane poles for garden decoration - Christmas Tree-1 to 5 (Solar)
Set of five solar LED snowman lawn lights with warm yellow glow and garden stakes - Snowman-1 to 5 (Solar Remote)
Solar LED candy cane lights with stars for Christmas garden path decoration - Star-1 to 5 (Solar)
Detailed view of 5-pack LED unicorn solar garden stakes with warm yellow glow - Santa Claus-1 to 5 (Solar)
+17
Christmas LED Solar Ground Plug Lights Waterproof Outdoor Garden Path Decoration Tree Snowman Star Snowflake Novelty
$8.93-12.97
No MOQ
Christmas Headband LED Glowing Santa Snowman Reindeer Antler Hair Hoop Festive Party Favors For Kids Adults
Christmas Headband LED Glowing Santa Snowman Reindeer Antler Hair Hoop Festive Party Favors For Kids Adults
like
Find Similar
Classic green Christmas tree headband with spring-loaded stars and white snowflakes - Standard (Green Tree)
Christmas headband with red velvet band and Santa Claus figures on metal springs - Standard (Santa Claus)
Christmas snowman headband with festive red snowflake hats and bows on white background - Standard (Snowman)
Christmas headband featuring red gloves with snowflake pattern on spring bobbles - Standard (Gloves)
+19
Christmas Headband LED Glowing Santa Snowman Reindeer Antler Hair Hoop Festive Party Favors For Kids Adults
$0.59-1.24
Mix MOQ : 60
 · 
12 sold recently
Christmas DIY Felt Gift Bags Cartoon Santa Claus Reindeer Snowman Candy Handbags For Kids Holiday Party Decoration Supplies
Christmas DIY Felt Gift Bags Cartoon Santa Claus Reindeer Snowman Candy Handbags For Kids Holiday Party Decoration Supplies
like
Find Similar
Christmas penguin felt gift bag with dimensions 13.5x18.3cm and red santa hat detail - Penguin Style
Green felt Christmas elf gift bag with dimensions 14x22cm and detailed size markers - Elf Costume Style
Red felt Christmas Santa Claus gift bag with dimensions 13.7cm by 14.2cm for candies - Santa Outfit Style
Christmas snowman felt gift bag in red house shape for kids sweets and holiday party favors - Red House Style
+19
Christmas DIY Felt Gift Bags Cartoon Santa Claus Reindeer Snowman Candy Handbags For Kids Holiday Party Decoration Supplies
-3%
$0.45-1.17
Mix MOQ : 2
Christmas Shaped Self Sealing Gift Packaging Bags Plastic CPP Resealable Cartoon Santa Snowman Candy Cookie Storage
Christmas Shaped Self Sealing Gift Packaging Bags Plastic CPP Resealable Cartoon Santa Snowman Candy Cookie Storage
like
Find Similar
Santa Claus shaped cartoon Christmas self-sealing gift bags showing front and back views - Santa Claus / M
Cute snowman shaped Christmas self-sealing gift bags showing front and back views - Snowman / Large
Christmas hat shaped ziplock gift bag with front and back view for holiday packaging - Christmas Hat / Wide Style
Cartoon Christmas gift box shaped self-sealing plastic bag for holiday packaging - Gift Box / Square
+8
Christmas Shaped Self Sealing Gift Packaging Bags Plastic CPP Resealable Cartoon Santa Snowman Candy Cookie Storage
$2.88-6.63
No MOQ
 · 
16 views
Merry Christmas Peach Skin Cushion Cover Santa Claus Reindeer Snowman Cartoon Print Festive Throw Pillowcase For Home Decor
Merry Christmas Peach Skin Cushion Cover Santa Claus Reindeer Snowman Cartoon Print Festive Throw Pillowcase For Home Decor
like
Find Similar
Christmas square throw pillow featuring cartoon turkey snowman illustrations on white - Snowman Turkey Style (1)
Christmas peach skin pillow featuring Santa playing golf with reindeer on a snowy roof - Santa Golfing Style (2)
Christmas peach skin pillowcase featuring festive Santa and polar bear cartoon print - Polar Bear and Sleigh Style (3)
Merry Christmas peach skin square pillowcase with Santa Claus riding a motorcycle - Motorcycle Jump Style (4)
+36
Merry Christmas Peach Skin Cushion Cover Santa Claus Reindeer Snowman Cartoon Print Festive Throw Pillowcase For Home Decor
-4%
$1.04
No MOQ
Christmas Multi Color Ballpoint Pen Plastic Rubber Cartoon Santa Snowman Topper Shuttle Pen Novelty Stationery Gift
Christmas Multi Color Ballpoint Pen Plastic Rubber Cartoon Santa Snowman Topper Shuttle Pen Novelty Stationery Gift
like
Find Similar
Christmas ten-color ballpoint pen with 3D Santa topper and festive snowman patterns - Santa Claus
10-color Christmas ballpoint pen with a 3D snowman topper and reindeer pattern - Snowman
10-color ballpoint pen with Santa Claus pattern and festive red Christmas hat topper - Christmas Hat
Christmas multi-color ballpoint pen with green tree cap and festive patterns - Christmas Tree
Christmas Multi Color Ballpoint Pen Plastic Rubber Cartoon Santa Snowman Topper Shuttle Pen Novelty Stationery Gift
$0.29
Mix MOQ : 2
 · 
27 sold recently
Christmas Squishy Toys PU Slow Rebound Stress Relief Novelty Desktop Decoration For Kids And Adults Santa Reindeer Snowman
Christmas Squishy Toys PU Slow Rebound Stress Relief Novelty Desktop Decoration For Kids And Adults Santa Reindeer Snowman
like
Find Similar
Yellow pear squishy toy with red bow, stress relief slow rebound figure, 6.3x8.3cm size - Christmas Bell
Brown reindeer squishy toy in Christmas sock with Santa hat and 9.4x6.4cm size - Christmas Reindeer Blue
Christmas tree squishy slow rising toy with colorful dots and star topper, 9x7.5cm - Christmas Tree
Cute slow rising snowman squishy toy in blue and red outfit, weight 32g, size 6x9.7cm - Snowman
+2
Christmas Squishy Toys PU Slow Rebound Stress Relief Novelty Desktop Decoration For Kids And Adults Santa Reindeer Snowman
$1.30
Mix MOQ : 2
 · 
27 views
Christmas Necklace Alloy Enamel Santa Snowman Tree Bell Pendant Wish Card Holiday Jewelry Gift For Women Fashion
Christmas Necklace Alloy Enamel Santa Snowman Tree Bell Pendant Wish Card Holiday Jewelry Gift For Women Fashion
like
Find Similar
Golden necklace with red and green Christmas tree pendant on a Merry Christmas card - Christmas Tree
Golden necklace with Santa Claus enamel pendant on a brown Merry Christmas wish card - Santa Claus A
Golden Christmas Santa Claus pendant necklace on a brown kraft paper wish card gift package - Santa Claus B
Christmas necklace with gold chain and red enamel ice skate pendant on brown card - Red Skate
Christmas Necklace Alloy Enamel Santa Snowman Tree Bell Pendant Wish Card Holiday Jewelry Gift For Women Fashion
-4%
$0.72
No MOQ
 · 
20 sold recently
Christmas Stocking Gift Bag Knitted Fabric Faux Fur Santa Snowman 3D Cartoon Fireplace Hanging Ornament Holiday Decor
Christmas Stocking Gift Bag Knitted Fabric Faux Fur Santa Snowman 3D Cartoon Fireplace Hanging Ornament Holiday Decor
like
Find Similar
Red knitted Christmas stocking with white tree pattern and plush cuff, 14x18cm - Red Christmas Tree Pattern (AGWZ12-1)
Red and grey Christmas stocking with plush cuff and diamond pattern, size 14x18cm - Grey Geometric Jacquard Style (AGWZ12-4)
Red and white knitted Christmas stocking featuring a 3D Santa Claus and snowflake pattern - 3D Stereo Santa Claus Style (AGWZ18-4)
Red Christmas stocking with snowman decor, 43cm knitted fabric holiday gift bag - 3D Stereo Snowman Style (AGWZ18-5)
+19
Christmas Stocking Gift Bag Knitted Fabric Faux Fur Santa Snowman 3D Cartoon Fireplace Hanging Ornament Holiday Decor
-5%
$1.31-9.58
No MOQ
Christmas Felt Ornaments Handmade Wool Needlework Snowman Elk Gnomes Hanging Decorations Festive DIY Craft Xmas Decor
Christmas Felt Ornaments Handmade Wool Needlework Snowman Elk Gnomes Hanging Decorations Festive DIY Craft Xmas Decor
like
Find Similar
Three handmade felt Christmas snowmen with red knit hats and green scarves for holiday decor - Snowman
Three green glitter felt candy cane ornaments with red bows and colorful bead accents - Green Exquisite Candy Cane
Three handmade red and white felt Santa Claus Christmas ornaments for festive DIY decor - Santa Head with Hat
Set of 5 handmade Christmas elk felt pendants with wooden beads for festive tree decor - 05 Reindeer Doll White
+19
Christmas Felt Ornaments Handmade Wool Needlework Snowman Elk Gnomes Hanging Decorations Festive DIY Craft Xmas Decor
$3.69-5.42
No MOQ
Free Shipping
Christmas Bead Chain Garland Star Snowman Icicle Hanging Ornaments Plastic Acrylic Party Tree Decor Holiday Novelty
Christmas Bead Chain Garland Star Snowman Icicle Hanging Ornaments Plastic Acrylic Party Tree Decor Holiday Novelty
like
Find Similar
2.7m clear acrylic bead garland with 0.7cm beads for Christmas tree decoration - Transparent Bead String
Garland of transparent multifaceted diamond-cut beads for wedding decoration 2.7m length - Transparent Diamond Bead String
Transparent faceted bead string with 1.5cm beads and 2.7m length for holiday decor - Transparent Globe Bead String
2.7m golden Christmas bead string featuring snowflake, snowman and tree motifs - Golden Snowman Bead String
+19
Christmas Bead Chain Garland Star Snowman Icicle Hanging Ornaments Plastic Acrylic Party Tree Decor Holiday Novelty
$1.24-9.22
No MOQ
Christmas Cookie Cutters Fondant Embossers Santa Snowman Tree House Patterns Plastic Acrylic Holiday Baking Tools
Christmas Cookie Cutters Fondant Embossers Santa Snowman Tree House Patterns Plastic Acrylic Holiday Baking Tools
like
Find Similar
White arch-shaped cookie cutter 4.7x8cm featuring Santa Claus embossing for baking - PC0019-Long Arch Cutter
Arched window cookie cutter for Christmas baking, 6.5x9.5cm white plastic mold - PC0198-Arch D Cutter
7cm white round fondant cookie cutter and plunger for Christmas baking molds - PC0206-Round Cutter
Christmas gift box cookie cutter with 1.5cm depth and 7.6x5.8cm size for baking - PC0208-Christmas Gift Cutter
+19
Christmas Cookie Cutters Fondant Embossers Santa Snowman Tree House Patterns Plastic Acrylic Holiday Baking Tools
-5%
$1.15-3.53
Mix MOQ : 2
Free Shipping
Christmas Pillowcase Polyester Peach Skin Square Throw Pillow Cover Santa Claus Snowman Cartoon For Home Sofa Decor
Christmas Pillowcase Polyester Peach Skin Square Throw Pillow Cover Santa Claus Snowman Cartoon For Home Sofa Decor
like
Find Similar
Christmas pillow cover featuring Santa Claus and Merry Christmas typography greeting - Santa Claus and Snowflake (DRD315-1)
Christmas Santa Claus cushion cover in red and beige with Merry Christmas greetings - Santa Claus Greetings (DRD315-2)
Red Christmas pillow cover with Santa and reindeer illustration and Merry Christmas text - Santa Claus and Reindeer (DRD315-3)
Square Christmas pillowcase featuring Santa Claus pattern and Merry Christmas greeting - Santa Claus Checklist (DRD315-4)
+19
Christmas Pillowcase Polyester Peach Skin Square Throw Pillow Cover Santa Claus Snowman Cartoon For Home Sofa Decor
-5%
$1.23
Mix MOQ : 2
Christmas Garden Flag Double Sided Linen Fabric Outdoor Yard Decor Merry Christmas Snowman Reindeer Festive Banner
Christmas Garden Flag Double Sided Linen Fabric Outdoor Yard Decor Merry Christmas Snowman Reindeer Festive Banner
like
Find Similar
Burlap Christmas garden flag with Welcome text and decorative trees on white background - Welcome with Christmas Trees (HYQ076-1)
Christmas garden flag with Joy to the World text on white linen and black metal stand - Joy to the world Ornaments (HYQ076-2)
Linen Christmas garden flag with Merry Christmas lettering and festive tree pattern - Merry Christmas Multi-Trees (HYQ076-3)
Christmas garden flag with tree patterns on red linen with black metal holder stand - Red Background Multi-Trees (HYQ076-4)
+5
Christmas Garden Flag Double Sided Linen Fabric Outdoor Yard Decor Merry Christmas Snowman Reindeer Festive Banner
$1.73
Mix MOQ : 2
Christmas Wooden Keychain Hollow Teardrop Cartoon Santa Reindeer Snowman Holiday Gift Ornament
Christmas Wooden Keychain Hollow Teardrop Cartoon Santa Reindeer Snowman Holiday Gift Ornament
like
Find Similar
Teardrop wooden Christmas keychain featuring a red parachute gift box pattern - Parachute Gift Box
Detail of wooden teardrop Christmas keychain with colorful 3D reindeer and silver metal ring - Reindeer with Bow
Detail of wooden teardrop Christmas keychain with reindeer and JOY engraving - JOY Reindeer and Snowman
Close-up of wooden teardrop Christmas keychain with a cartoon reindeer and silver ring - Reindeer with Santa Hat
+5
Christmas Wooden Keychain Hollow Teardrop Cartoon Santa Reindeer Snowman Holiday Gift Ornament
-8%
$0.34
No MOQ
 · 
24 views
Snowman Christmas Plush Decoration Large Holiday Figurine With Knitted Hat Scarf Earmuffs Welcome Sign Festive Home Decor
Snowman Christmas Plush Decoration Large Holiday Figurine With Knitted Hat Scarf Earmuffs Welcome Sign Festive Home Decor
like
Find Similar
Plush Christmas snowman doll with red knitted hat and welcome star, 35cm height - Earmuff Snowman - 30 (Height 35cm)
Plush Christmas snowman figurine in red hat with star welcome sign and 45cm size specs - Earmuff Snowman - 45 (Height 45cm)
Extra large 205cm Christmas snowman with WELCOME sign and red striped hat - Earmuff Snowman - 145 (Height 205cm)
Extra large 165cm Christmas snowman figurine with red hat and welcome sign - Earmuff Snowman - 165 (Height 165cm)
+5
Snowman Christmas Plush Decoration Large Holiday Figurine With Knitted Hat Scarf Earmuffs Welcome Sign Festive Home Decor
$4.27-345.82
No MOQ
Christmas Santa Snowman Reindeer Doll Ornaments Knitted Plush Festive Decor Standing Sitting Telescopic Figurines
Christmas Santa Snowman Reindeer Doll Ornaments Knitted Plush Festive Decor Standing Sitting Telescopic Figurines
like
Find Similar
Standing Santa plush doll with red knit hat and heart button, 25cm festive decoration - Standing Position / Standing Santa Claus (Red)
Christmas snowman plush doll in red sweater and striped scarf for festive holiday decoration - Standing Position / Standing Snowman (Red)
Standing reindeer Christmas plush doll in red sweater with 25cm height and 160g weight - Standing Position / Standing Reindeer (Red)
Plush Santa doll with long legs in red and gray, 55cm height Christmas ornament - Hanging Leg Style / Long Leg Santa Claus (Red)
+5
Christmas Santa Snowman Reindeer Doll Ornaments Knitted Plush Festive Decor Standing Sitting Telescopic Figurines
$3.31-9.37
No MOQ
 · 
10 views
Christmas Snowing Lantern LED Music Box Retro Metal Lamp Post Santa Snowman Scene Holiday Home Party Decor Ornament
Christmas Snowing Lantern LED Music Box Retro Metal Lamp Post Santa Snowman Scene Holiday Home Party Decor Ornament
like
Find Similar
Standing 1.3M Christmas lantern tower with Santa Claus and reindeer festive scene - 1.3M / Santa & Deer Lamp Post
Red 1.3M Christmas lamp post with Santa and Snowman inside a musical snowy lantern - 1.3M / Santa & Snowman Lamp Post
1.3M Christmas street lamp post with snowman lantern and red decorative base - 1.3M / Christmas Kids Lamp Post
40CM Red Christmas Santa Claus Water Globe Lantern with swirling snow and lights - 40CM / Kerosene Lamp Style - Red
+5
Christmas Snowing Lantern LED Music Box Retro Metal Lamp Post Santa Snowman Scene Holiday Home Party Decor Ornament
$98.27-136.60
No MOQ
 · 
14 views
Free Shipping
Christmas Drawstring Gift Bags Plastic Ribbon Bow Candy Packaging Party Favors Santa Snowman Deer Printed Holiday Festive
Christmas Drawstring Gift Bags Plastic Ribbon Bow Candy Packaging Party Favors Santa Snowman Deer Printed Holiday Festive
like
Find Similar
Silver foil Christmas gift bag with Santa Claus patterns and white drawstring close-up - 29*43 Premium Silver
Close-up of Santa Claus drawstring gift bag with festive snowman and ribbon on wood - 39*51 White Snowman
Light blue Merry Christmas drawstring gift bag with Santa and penguin holiday pattern - 24*32 Sky Blue
Green Christmas gift bag featuring Santa, snowman and reindeer cartoons in variant style - 24*32 Christmas Green
+5
Christmas Drawstring Gift Bags Plastic Ribbon Bow Candy Packaging Party Favors Santa Snowman Deer Printed Holiday Festive
$0.14-0.35
No MOQ
 · 
75 sold recently
Christmas Plush Bucket Hat For Women White Faux Fur Winter Warm Fisherman Hat With Santa Snowman Embroidery Outdoor
Christmas Plush Bucket Hat For Women White Faux Fur Winter Warm Fisherman Hat With Santa Snowman Embroidery Outdoor
like
Find Similar
Detailed view of white plush bucket hat with festive Christmas tree embroidery - M / Christmas Tree Pattern White
Detail of soft white plush winter bucket hat with embroidered Santa Claus pattern - M / Santa Claus Pattern White
Detail of white faux fur bucket hat featuring a colorful Christmas stocking embroidery - M / Christmas Stocking Pattern White
Detailed view of Christmas bell embroidery on white plush faux fur bucket hat - M / Christmas Bells Pattern White
+5
Christmas Plush Bucket Hat For Women White Faux Fur Winter Warm Fisherman Hat With Santa Snowman Embroidery Outdoor
$4.32
No MOQ
 · 
14 views
Christmas Window Stickers Static Cling PVC Reindeer Snowman Santa Claus Snowflakes Holiday Glass Decals For Decoration
Christmas Window Stickers Static Cling PVC Reindeer Snowman Santa Claus Snowflakes Holiday Glass Decals For Decoration
like
Find Similar
Gingerbread man and reindeer Christmas window static stickers for glass decor - 2-Pack Set Gingerbread Man & Reindeer Sock (BQ481+483)
Christmas window stickers featuring Santa, snowman, and reindeer for holiday decoration - 2-Pack Set Santa Claus & Snowman (BQ482+486)
Christmas window decals set with Santa, snowman and snowflake static stickers - 2-Pack Set Peeking Santa & Snowman Penguin (BQ484+487)
Gingerbread man and Santa Claus static window stickers for Christmas home party decor - 2-Pack Set Snow House & Merry Christmas (BQ488+491)
+20
Christmas Window Stickers Static Cling PVC Reindeer Snowman Santa Claus Snowflakes Holiday Glass Decals For Decoration
$0.26-2.42
Mix MOQ : 2
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Reindeer Snowman Tree Hat Holiday Decorative Jewelry For Women Men
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Reindeer Snowman Tree Hat Holiday Decorative Jewelry For Women Men
like
Find Similar
Christmas stocking brooch with Santa and snowman patterns in red alloy and white finish - Christmas Sock Style(16BC262)
Christmas tree brooch with green enamel and sparkling rhinestones in a golden finish - Christmas Tree Style(16BC267)
Christmas Santa hat brooch in red enamel with silver stars and white sparkling crystals - Red Star Christmas Hat Style(16BC260)
Christmas bell brooch with red enamel and colorful rhinestones in golden alloy finish - Festive Bell Style(16BC243)
+2
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Reindeer Snowman Tree Hat Holiday Decorative Jewelry For Women Men
-9%
$0.94-1.18
No MOQ
 · 
39 sold recently
Free Shipping
Christmas Flocked Jewelry Box Creative Santa Claus Snowman Tree Shape Ring Necklace Earring Packaging Case For Holiday Gift
Christmas Flocked Jewelry Box Creative Santa Claus Snowman Tree Shape Ring Necklace Earring Packaging Case For Holiday Gift
like
Find Similar
Navy blue gift bag and green Christmas tree velvet jewelry box with matching card - Christmas Tree Box (Dark Green Bag Set)
Christmas Santa Claus jewelry box set with green gift bag and Merry Christmas card - Santa Claus Box (Dark Green Bag Set)
Christmas gift set with green tree velvet jewelry box, red paper bag and card - Christmas Tree Box (Burgundy Bag Set)
Christmas jewelry gift set with red Santa box, gift bag and festive greeting card - Santa Claus Box (Burgundy Bag Set)
+3
Christmas Flocked Jewelry Box Creative Santa Claus Snowman Tree Shape Ring Necklace Earring Packaging Case For Holiday Gift
-13%
$2.99-3.24
No MOQ
 · 
41 views
Christmas Linen Ribbon With Red Truck Snowman Printed Burlap Ribbon For Christmas Tree Decorations Festive Party Gift Wrapping Supplies
Christmas Linen Ribbon With Red Truck Snowman Printed Burlap Ribbon For Christmas Tree Decorations Festive Party Gift Wrapping Supplies
like
Find Similar
5cm Christmas snowman pattern linen-style ribbon for festive gift wrapping and tree decor - Snowman Pattern (2m)
Red 5cm Christmas ribbon with vintage truck and green tree pattern in S-shape curve - Red Car Pattern (2m)
5cm Christmas ribbon with red vintage truck and Xmas tree prints on white fabric - Cream Car Pattern (2m)
Christmas ribbon with vintage car and Christmas tree prints on silver glitter fabric - Gray Car Pattern (2m)
+21
Christmas Linen Ribbon With Red Truck Snowman Printed Burlap Ribbon For Christmas Tree Decorations Festive Party Gift Wrapping Supplies
-5%
$0.82-3.29
Mix MOQ : 2
Christmas Beaded Bracelets Multilayer Acrylic Alloy Enamel Santa Reindeer Snowman Charms Elastic Holiday Jewelry For Women
Christmas Beaded Bracelets Multilayer Acrylic Alloy Enamel Santa Reindeer Snowman Charms Elastic Holiday Jewelry For Women
like
Find Similar
Detail view of four-piece Christmas beaded bracelet set with bells and snowflake charms - Red Green White Mix-Bell Snowflake Charm
Christmas snowman and glove charms beaded bracelet set with detailed sizing and dimensions - White-Snowman Glove Charm
Green Christmas beaded bracelet set with elk and star tree charms on display card - Green-Elk Christmas Tree Charm
Detailed view of red Christmas beaded bracelets with Santa and reindeer charms on size card - Red-Santa Claus Elk Charm
Christmas Beaded Bracelets Multilayer Acrylic Alloy Enamel Santa Reindeer Snowman Charms Elastic Holiday Jewelry For Women
$0.97
No MOQ
Holographic Glitter Festive Stickers Roll 500Pcs Halloween Pumpkin Ghost Turkey Snowman Carrot Sunflower Pencil Decals For Gift Sealing
Holographic Glitter Festive Stickers Roll 500Pcs Halloween Pumpkin Ghost Turkey Snowman Carrot Sunflower Pencil Decals For Gift Sealing
like
Find Similar
Macro detail of laser glitter candy corn stickers for Halloween gift packaging - Halloween Candy Corn Style (CH36)
Sunflower shaped laser glitter sticker roll for decorative gift sealing and labels - Yellow Sunflower Style (CH34)
Macro detail of glittery carrot sticker roll for Easter gift wrapping and scrapbooking - Orange Carrot Style (CH30)
Macro detail of ladybug laser stickers with holographic glitter finish on a white roll - Red Black Ladybug Style (CH31)
+6
Holographic Glitter Festive Stickers Roll 500Pcs Halloween Pumpkin Ghost Turkey Snowman Carrot Sunflower Pencil Decals For Gift Sealing
-4%
$0.69-0.96
No MOQ
Christmas Window Stickers Static Cling PVC Double Sided Holiday Glass Decals Santa Snowman Reindeer Snowflake Decor
Christmas Window Stickers Static Cling PVC Double Sided Holiday Glass Decals Santa Snowman Reindeer Snowflake Decor
like
Find Similar
Christmas window sticker featuring cartoon reindeer and snowflake, 20x30cm decal sheet - Model 06 Cute Reindeer
Cartoon Santa Claus double-sided window stickers with snowflakes in red and white - Model 01 Santa Claus
Christmas reindeer window stickers 20x30cm, double-sided static decal with 28 pieces - Model 02 Reindeer
Christmas window stickers set with Santa and snowman patterns, size 20x30cm, 26 pieces - Model 03 Festive Mix
+17
Christmas Window Stickers Static Cling PVC Double Sided Holiday Glass Decals Santa Snowman Reindeer Snowflake Decor
-3%
$0.31
No MOQ
Christmas Ornaments Resin Hand Painted Tree Hanging Decoration Santa Claus Snowman Gingerbread Man Festive Party Home Decor
Christmas Ornaments Resin Hand Painted Tree Hanging Decoration Santa Claus Snowman Gingerbread Man Festive Party Home Decor
like
Find Similar
Exquisite cream snowflake Christmas tree ornament with golden trim and rustic twine hanger - Style A: Christmas Snowflake
Resin Christmas tree ornament with white snow edges and red berries on a hemp cord - Style B: Christmas Tree
Red resin gift bag ornament featuring a snowman with Let It Snow text hanging on a tree - Style C: Snowman Gift Bag
Santa Claus in red sleigh resin ornament hanging on green Christmas tree branch - Style D: Santa Sled
+16
Christmas Ornaments Resin Hand Painted Tree Hanging Decoration Santa Claus Snowman Gingerbread Man Festive Party Home Decor
-5%
$1.04-1.15
No MOQ
Christmas Wool Felt Hanging Ornaments Handmade Festive Tree Decorations Santa Reindeer Snowman Stocking Glove Star Fabric
Christmas Wool Felt Hanging Ornaments Handmade Festive Tree Decorations Santa Reindeer Snowman Stocking Glove Star Fabric
like
Find Similar
Set of 5 handmade Christmas elk felt pendants with wooden beads for festive tree decor - Reindeer Doll / White
Five handmade wool felt reindeer dolls with antlers for Christmas tree decor - Reindeer Doll / Brown
Pair of red wool felt Christmas stocking ornaments with golden snowflake embroidery - Christmas Sock / Red
Red Christmas wool felt gift box charms with white dots and green bow for DIY crafts - Gift Box / Red
+16
Christmas Wool Felt Hanging Ornaments Handmade Festive Tree Decorations Santa Reindeer Snowman Stocking Glove Star Fabric
$3.46-3.75
Mix MOQ : 2
Free Shipping
Christmas Tie For Kids Glitter Felt Cloth Adjustable Holiday Party Costume Accessory Snowman Reindeer Santa Pattern
Christmas Tie For Kids Glitter Felt Cloth Adjustable Holiday Party Costume Accessory Snowman Reindeer Santa Pattern
like
Find Similar
Sparkly red felt Christmas elf tie with green bow and size markers for party decor - Elf Hat & Legs Style
Detail of Christmas Santa necktie with red sequins and 41cm size specifications - Santa Outfit Style
Golden sequin Christmas felt tie with gnome design and adjustable neck strap, 25cm - Gold Christmas Gnome Style
Detailed size specifications of glittery Christmas tree felt tie with 41cm length - Christmas Tree Berries Style
+16
Christmas Tie For Kids Glitter Felt Cloth Adjustable Holiday Party Costume Accessory Snowman Reindeer Santa Pattern
-4%
$0.88
Mix MOQ : 2
 · 
17 views
Free Shipping
Christmas Sweater Keychain Glitter Acrylic Reindeer Santa Snowman Pendant Holiday Gift Bag Charm
Christmas Sweater Keychain Glitter Acrylic Reindeer Santa Snowman Pendant Holiday Gift Bag Charm
like
Find Similar
Festive red glitter acrylic Christmas sweater keychain with cute reindeer and silver clasp - Red Sweater Elk
Detail of red glitter Christmas sweater keychain with a silver metal lobster clasp - Red Sweater Green Body
Detail of green glitter acrylic Christmas sweater keychain with snowman and metal clasp - Green Sweater Snowman
Christmas green glitter sweater keychain featuring Santa Claus with silver metal clasp - Green Santa Claus
Christmas Sweater Keychain Glitter Acrylic Reindeer Santa Snowman Pendant Holiday Gift Bag Charm
-9%
$0.68
Mix MOQ : 2
 · 
97 sold recently
Christmas Reindeer Snowman Santa Claus Print Peach Skin Velvet Square Pillowcase Winter Holiday Decorative Throw Cushion Cover
Christmas Reindeer Snowman Santa Claus Print Peach Skin Velvet Square Pillowcase Winter Holiday Decorative Throw Cushion Cover
like
Find Similar
Christmas deer peach skin pillowcase with winter scene and gold accents on white background - Winter Fairytale Deer Style (1)
Christmas deer pillowcase with watercolor reindeer and festive golden ornaments print - Winter Cuddly Deer Style (2)
Detail of Christmas reindeer pillowcase showing vintage watercolor angel and rabbit print - Angel and Rabbit Style (3)
Square peach skin pillowcase featuring Christmas deer and forest animals art print - Winter Forest Animals Style (4)
+36
Christmas Reindeer Snowman Santa Claus Print Peach Skin Velvet Square Pillowcase Winter Holiday Decorative Throw Cushion Cover
$1.09
No MOQ
Christmas Round Coin Purse Tinplate Storage Bag With Zipper Lanyard Cartoon Santa Snowman For Party Favors Holiday Gifts
Christmas Round Coin Purse Tinplate Storage Bag With Zipper Lanyard Cartoon Santa Snowman For Party Favors Holiday Gifts
like
Find Similar
Red round Christmas coin purse with Santa, snowman and reindeer motifs and zip - Santa Snowman & Reindeer
Red Christmas coin purse with round hard shell zipper case and Santa Claus pattern - Santa Elf & Tree
Christmas Santa Claus round tinplate coin purse and earphone storage case with red lanyard - White Beard Santa
Christmas tinplate coin purse featuring Santa and snowman illustrations with hand strap - Santa & Snowman
Christmas Round Coin Purse Tinplate Storage Bag With Zipper Lanyard Cartoon Santa Snowman For Party Favors Holiday Gifts
-5%
$0.52
No MOQ
 · 
45 sold recently
Christmas LED Candle Light Glitter Water Snow Globe Santa Snowman Retro Bronze Base Plastic Holiday Home Decor Ornament
Christmas LED Candle Light Glitter Water Snow Globe Santa Snowman Retro Bronze Base Plastic Holiday Home Decor Ornament
like
Find Similar
Detail of Christmas lantern with Santa scene, glitter snow, and warm LED light effect - Santa Claus
Detail of LED Christmas candle lamp featuring a snowman snow globe scene and rustic base - Snowman
Detail of Christmas LED snow globe candle with mini tree and festive glitter inside - Christmas Tree
Detail of LED Christmas candle lamp featuring a golden angel statue and swirling glitter - Angel Style
Christmas LED Candle Light Glitter Water Snow Globe Santa Snowman Retro Bronze Base Plastic Holiday Home Decor Ornament
$3.03
No MOQ
Christmas Snowman Wall Stickers PVC DIY Cartoon Fridge Door Decals Festive Window Clings Holiday Home Decor
Christmas Snowman Wall Stickers PVC DIY Cartoon Fridge Door Decals Festive Window Clings Holiday Home Decor
like
Find Similar
Snowflake wall stickers TBW9481-B in blue for Christmas DIY home decor 28x23cm - TBW9481B-Blue Snowflakes (28cmx23cm)
DIY Christmas snowman wall decal set with red scarf, black hat and carrot nose stickers - TBW9530-UV-Snowman DIY Kit (49cmx36cm)
DIY Christmas wall stickers featuring Santa, snowman and reindeer designs for home decor - TBW9536-UV-Xmas Characters Collection (99cmx36cm)
Detail view of 26x49cm DIY snowman wall sticker sheet with hat, scarf and carrot nose - TBW9549-UV-Red Scarf Snowman (26cmx49cm)
+9
Christmas Snowman Wall Stickers PVC DIY Cartoon Fridge Door Decals Festive Window Clings Holiday Home Decor
-5%
$1.31-2.93
Mix MOQ : 2
Free Shipping
Christmas Refrigerator Magnets 3D Resin Santa Claus Gingerbread Man Snowman Holiday Fridge Stickers Home Decor Accessory
Christmas Refrigerator Magnets 3D Resin Santa Claus Gingerbread Man Snowman Holiday Fridge Stickers Home Decor Accessory
like
Find Similar
Santa Claus resin fridge magnet with red heart 6cm magnetic Christmas decoration - Heart Santa
3D Santa Claus fridge magnet with gift bag in festive red and white, 8cm height - Santa with Bag
3D Santa Claus magnetic fridge sticker holding gift bag, holiday decor, 9cm height - Santa with Gift Bag Magnet
Christmas snowman fridge magnet with red scarf and black hat in 3D resin style, 6cm tall - Large Snowman with Red Scarf
+9
Christmas Refrigerator Magnets 3D Resin Santa Claus Gingerbread Man Snowman Holiday Fridge Stickers Home Decor Accessory
$2.54
Mix MOQ : 2
Free Shipping
Christmas Hanging Ornaments Metal Iron Pendants Santa Snowman Star Shape Tree Decorations Vintage Festive Home Decor
Christmas Hanging Ornaments Metal Iron Pendants Santa Snowman Star Shape Tree Decorations Vintage Festive Home Decor
like
Find Similar
Christmas iron gift box ornament with red bow, holly leaves, and bells in white finish - White Gift Box Iron Ornament
Christmas tree red gift box iron pendant with green bow and gold bells 9.5x6cm - Red Gift Box Iron Ornament
Red iron Christmas ornament with white snowflakes, double-sided print, size 10x8cm - Red Round Plate Iron Ornament
White iron Christmas tree ornament with red Merry Christmas text and rustic twine hanger - White Tree with Letters Iron Ornament
+9
Christmas Hanging Ornaments Metal Iron Pendants Santa Snowman Star Shape Tree Decorations Vintage Festive Home Decor
$1.30-1.96
No MOQ
Free Shipping
Christmas Foil Fringe Curtains And Tablecloths Metallic Snowman Santa Patterns Holiday Party Backdrop Home Decoration
Christmas Foil Fringe Curtains And Tablecloths Metallic Snowman Santa Patterns Holiday Party Backdrop Home Decoration
like
Find Similar
Pink Christmas fringe curtain with snowman and tree patterns for party decoration - Christmas Pink Square Foil Curtain (1*2m)
Metallic red foil fringe curtain with Christmas tree shapes for festive party backdrop - Red Christmas Tree Foil Curtain (1*2m)
Green Christmas tree foil fringe curtain with metallic shine for festive party decoration - Green Christmas Tree Foil Curtain (1*2m)
Christmas tablecloth with green base featuring gingerbread man and teddy bear patterns - Christmas Tablecloth - Gift Bear (137x183cm)
+9
Christmas Foil Fringe Curtains And Tablecloths Metallic Snowman Santa Patterns Holiday Party Backdrop Home Decoration
$0.72-0.86
No MOQ
 · 
10 views
Christmas Brooches Alloy Rhinestone Enamel Faux Artificial Pearl Snowman Santa Claus Reindeer Tree Bell Holiday Party Festival Jewelry
Christmas Brooches Alloy Rhinestone Enamel Faux Artificial Pearl Snowman Santa Claus Reindeer Tree Bell Holiday Party Festival Jewelry
like
Find Similar
Christmas snowman brooch featuring white imitation pearls and red enamel hat on gold base - Skateboard Sled - Brooch
Enamel snowman brooch with pearl body and gold skis decorated with colorful rhinestones - Broom Sled - Brooch
Christmas snowman brooch with pearl body and red hat, 4.7cm x 4.0cm dimensions - White Pearl Christmas Snowman - Brooch
Christmas tree brooch with green enamel and sparkling rhinestones on a golden base - Green Crystal Christmas Tree - Brooch
+9
Christmas Brooches Alloy Rhinestone Enamel Faux Artificial Pearl Snowman Santa Claus Reindeer Tree Bell Holiday Party Festival Jewelry
-9%
$0.63-1.52
No MOQ
 · 
15 views
Free Shipping
Christmas Silicone Cake Mold Snowman Gingerbread Man Candy Cane Tree Shapes For Baking Chocolate Candy Jelly DIY Holiday
Christmas Silicone Cake Mold Snowman Gingerbread Man Candy Cane Tree Shapes For Baking Chocolate Candy Jelly DIY Holiday
like
Find Similar
2 options
Christmas Silicone Cake Mold Snowman Gingerbread Man Candy Cane Tree Shapes For Baking Chocolate Candy Jelly DIY Holiday
-5%
$1.45
Mix MOQ : 2
 · 
39 views
Christmas Wine Gift Bags Kraft Paper Bottle Packaging With Handle Festive Party Patterns Santa Snowman Xmas Tree
Christmas Wine Gift Bags Kraft Paper Bottle Packaging With Handle Festive Party Patterns Santa Snowman Xmas Tree
like
Find Similar
Christmas Kraft paper wine gift bag with cartoon Santa Claus and tree patterns - Kraft Paper [Style 1 - Santa & Tree]
Christmas Kraft paper wine gift bag with festive snowman and holiday wreath illustrations - Kraft Paper [Style 2 - Snowman & Wreath]
Tall Christmas kraft paper wine gift bag with festive wreath print and twisted rope handles - Kraft Paper [Style 3 - Xmas Ornament Wreath]
Christmas kraft paper wine gift bag with Santa Claus pattern and sturdy rope handles - Kraft Paper [Style 4 - Cute Santa]
Christmas Wine Gift Bags Kraft Paper Bottle Packaging With Handle Festive Party Patterns Santa Snowman Xmas Tree
$0.43
No MOQ
 · 
52 sold recently
Christmas Mid Calf Socks Cotton Blend Festive Santa Claus Reindeer Snowman Gingerbread Pattern Holiday Gift Unisex
Christmas Mid Calf Socks Cotton Blend Festive Santa Claus Reindeer Snowman Gingerbread Pattern Holiday Gift Unisex
like
Find Similar
Festive Christmas mid-calf cotton socks with Santa Claus and HO HO HO pattern - One Size / White and Red Santa (1100)
Christmas crew socks featuring Santa Claus design with red and green knit pattern - One Size / Green and Red Santa Belt Style (1101)
Green Christmas mid-calf cotton socks with festive Santa and snowman patterns - One Size / Green Cartoon Snowman and Santa (1103)
Green Christmas mid-calf cotton socks with gingerbread man and snowflake patterns - One Size / Green Gingerbread and Snowflake (1104)
+5
Christmas Mid Calf Socks Cotton Blend Festive Santa Claus Reindeer Snowman Gingerbread Pattern Holiday Gift Unisex
$1.15
Mix MOQ : 10
 · 
20 views
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access