Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Stockings Mini Gift Bags Santa Snowman Reindeer Non-Woven Fabric Plaid Ornaments Fireplace Hanging Candy Pouch
Christmas Stockings Mini Gift Bags Santa Snowman Reindeer Non-Woven Fabric Plaid Ornaments Fireplace Hanging Candy Pouch
like
Find Similar
Red Christmas stocking with 3D Santa Claus and Merry Christmas text on snowy tree - SDW038 Santa Stocking
Red knit Christmas stocking with snowman pattern, green bow and golden embroidery - SDW038 Snowman Stocking
Christmas stocking with reindeer 3D design and gold Merry Christmas text hanging on a tree - SDW038 Reindeer Stocking
Red Christmas stocking gift bag with a small white bear plush and Merry Christmas text - SDW038 Bear Stocking
+14
Christmas Stockings Mini Gift Bags Santa Snowman Reindeer Non-Woven Fabric Plaid Ornaments Fireplace Hanging Candy Pouch
$0.63
Mix MOQ : 2
 · 
46 sold recently
Christmas Resin Miniature Ornaments Santa Claus Snowman Reindeer Animal Figurines Desktop Decorative Festive Holiday Gifts
Christmas Resin Miniature Ornaments Santa Claus Snowman Reindeer Animal Figurines Desktop Decorative Festive Holiday Gifts
like
Find Similar
Christmas hedgehog resin ornament with red hat and cup, sized 5cm by 3.5cm - Christmas Hedgehog
Miniature Santa Claus figurine holding a blue gift box for Christmas tree decor - Christmas Santa Claus
Miniature resin reindeer figurine with red Christmas hat and candy cane, 5cm tall - Christmas Reindeer
Christmas Corgi resin ornament with Santa hat and gift box, 5cm height mini figurine - Christmas Puppy
+17
Christmas Resin Miniature Ornaments Santa Claus Snowman Reindeer Animal Figurines Desktop Decorative Festive Holiday Gifts
$1.21-2.45
Mix MOQ : 2
Christmas Snowman Glass Cup Hammered Texture Transparent Cartoon Juice Coffee Milk Drinkware Festive Gift
Christmas Snowman Glass Cup Hammered Texture Transparent Cartoon Juice Coffee Milk Drinkware Festive Gift
like
Find Similar
Detail of Christmas snowman glass with textured hammered finish and festive cartoon prints - 300ml / Christmas Snowman Style
Christmas Snowman Glass Cup Hammered Texture Transparent Cartoon Juice Coffee Milk Drinkware Festive Gift
-19%
$1.73
No MOQ
Christmas Stockings Hanging Gift Bags Felt Fabric 3D Cartoon Santa Snowman Reindeer Bear Plaid Cuffs Decoration
Christmas Stockings Hanging Gift Bags Felt Fabric 3D Cartoon Santa Snowman Reindeer Bear Plaid Cuffs Decoration
like
Find Similar
Detail of red felt Christmas stocking with 3D snowman doll and snowflake embroidery - Snowman Style with Bells (E3-1)
Detail of red Christmas stocking with reindeer head and snowflake pattern hanging on a rope - Deer Style with Bells (E3-1)
Detail of red Christmas stocking with plaid trim and 3D plush bear hanging decoration - Bear Style with Bells (E3-1)
Christmas stocking with Santa Claus applique and green sequin cuff in festive setting - Santa Style with Sequins (E1-1)
+16
NewChristmas Stockings Hanging Gift Bags Felt Fabric 3D Cartoon Santa Snowman Reindeer Bear Plaid Cuffs Decoration
-5%
$0.55
No MOQ
Christmas Stocking Hanging Decoration Felt Fabric 3D Santa Snowman Reindeer Bear Character Sequin Bell Holiday Party Gift Bag
Christmas Stocking Hanging Decoration Felt Fabric 3D Santa Snowman Reindeer Bear Character Sequin Bell Holiday Party Gift Bag
like
Find Similar
Detail of red felt Christmas stocking with 3D snowman doll and snowflake embroidery - Snowman Style With Bell (E3-1)
Detail of red Christmas stocking with reindeer head and snowflake pattern hanging on a rope - Reindeer Style With Bell (E3-1)
Detail of red Christmas stocking with plaid trim and 3D plush bear hanging decoration - Bear Style With Bell (E3-1)
Detail of red Christmas stocking with Santa Claus and plaid cuff on white textured wall - Plaid Santa Claus Style (E1-2)
+16
Christmas Stocking Hanging Decoration Felt Fabric 3D Santa Snowman Reindeer Bear Character Sequin Bell Holiday Party Gift Bag
$0.54-0.58
No MOQ
Christmas Stockings Felt Hanging Ornaments Santa Snowman Reindeer Bear Plaid Sequins Holiday Party Home Decor Gift Bags
Christmas Stockings Felt Hanging Ornaments Santa Snowman Reindeer Bear Plaid Sequins Holiday Party Home Decor Gift Bags
like
Find Similar
Detail of red felt Christmas stocking with 3D snowman doll and snowflake embroidery - Bell Sock - Snowman
Detail of red Christmas stocking with reindeer head and snowflake pattern hanging on a rope - Bell Sock - Reindeer
Detail of red Christmas stocking with plaid trim and 3D plush bear hanging decoration - Bell Sock - Bear
Christmas stocking with Santa Claus applique and green sequin cuff in festive setting - Sequin Sock - Santa Claus
+16
Christmas Stockings Felt Hanging Ornaments Santa Snowman Reindeer Bear Plaid Sequins Holiday Party Home Decor Gift Bags
$0.58
No MOQ
Christmas Stockings Hanging Decorations Felt Fabric 3D Cartoon Santa Snowman Reindeer Bear Sequin Plaid Cuffs Ornaments
Christmas Stockings Hanging Decorations Felt Fabric 3D Cartoon Santa Snowman Reindeer Bear Sequin Plaid Cuffs Ornaments
like
Find Similar
Detail of red felt Christmas stocking with 3D snowman doll and snowflake embroidery - Bell Sock Snowman Style (E3-1)
Detail of red Christmas stocking with reindeer head and snowflake pattern hanging on a rope - Bell Sock Deer Style (E3-1)
Detail of red Christmas stocking with plaid trim and 3D plush bear hanging decoration - Bell Sock Bear Style (E3-1)
Christmas stocking with Santa Claus applique and green sequin cuff in festive setting - Sequin Sock Santa Style (E1-1)
+16
Christmas Stockings Hanging Decorations Felt Fabric 3D Cartoon Santa Snowman Reindeer Bear Sequin Plaid Cuffs Ornaments
$0.58
No MOQ
Christmas Placemats Waterproof Linen Cotton Heat Resistant Non-Slip Table Mats Snowman Santa Reindeer Festive Dining Decor
Christmas Placemats Waterproof Linen Cotton Heat Resistant Non-Slip Table Mats Snowman Santa Reindeer Festive Dining Decor
like
Find Similar
Rectangular Christmas placemat with snowman and wreath on a dark wood table - 30*45CM Cotton Linen / Wreath Snowman
Christmas snowman and nativity scene placemat on a dark wooden table setting - 30*45CM Cotton Linen / Nativity Scene
Christmas placemat with Nordic snow scene, Santa, and elk on a black wooden table - 30*45CM Cotton Linen / Nordic Snow View
Christmas snowman placemat with blue vintage truck and reindeer on a dark wood table - 30*45CM Cotton Linen / Blue Truck Snowman
+16
Christmas Placemats Waterproof Linen Cotton Heat Resistant Non-Slip Table Mats Snowman Santa Reindeer Festive Dining Decor
$1.38
Mix MOQ : 2
Christmas Snowman Snowflake Window Stickers Electrostatic PVC Decals Double Sided Reusable Glass Door Decoration
Christmas Snowman Snowflake Window Stickers Electrostatic PVC Decals Double Sided Reusable Glass Door Decoration
like
Find Similar
Merry Christmas snowman static window sticker with snowflake patterns for festive decor - Snowman Style 1 (SDUV-430-2) / Small (35*60CM)
Christmas snowman and stars static window cling stickers for festive holiday decor - Snowman Style 2 (SDUV-430-3) / Small (35*60CM)
UV printed Christmas window sticker with snowflakes and gift boxes on static cling film - Holiday Decor 1 (SDUV-430-4) / Small (40*20CM)
Christmas window decals with Santa Claus design, available in 5 sizes for festive decoration - Holiday Decor 2 (SDUV-430-5) / Small (40*20CM)
+16
Christmas Snowman Snowflake Window Stickers Electrostatic PVC Decals Double Sided Reusable Glass Door Decoration
$1.26-27.32
No MOQ
Christmas Tree Hanging Ornaments Painted Plastic Festive Pendants Snowman Car Candy Cane For Holiday Party Decoration
Christmas Tree Hanging Ornaments Painted Plastic Festive Pendants Snowman Car Candy Cane For Holiday Party Decoration
like
Find Similar
Car snowman Christmas ornament with a green glitter tree and white resin car - Car with Snowman Style
Red and white vintage RV Christmas tree ornament hanging on a pine branch, size 8x10.5cm - White Car Style
Red and white candy cane Christmas ornament with gold bow decoration, 13.5x6.5cm - Candy Cane Style
Red candy house Christmas tree ornament with glitter snow and green window details - Christmas House
+16
Christmas Tree Hanging Ornaments Painted Plastic Festive Pendants Snowman Car Candy Cane For Holiday Party Decoration
$2.77-3.11
No MOQ
Free Shipping
Christmas Hanging Ornaments Santa Claus Snowman Reindeer Bear Plush Dolls Festive Tree Decorations Cloth Art Home Decor
Christmas Hanging Ornaments Santa Claus Snowman Reindeer Bear Plush Dolls Festive Tree Decorations Cloth Art Home Decor
like
Find Similar
23cm Christmas snowman plush pendant with red plaid hat and Merry Christmas sign - Plaid Hat/Long Leg Design / Style E Snowman
Plaid reindeer Christmas tree ornament with JOY text and green striped scarf, 20cm - Red Black Plaid/JOY Tag / Style A Reindeer
Plush Santa Claus hanging ornament with Merry Christmas sign and red plaid hat, 20x10cm - Plaid Hat/Merry Christmas Sign / Style B Santa
Plush Christmas snowman pendant with Merry Christmas sign, size 20x10cm holiday decor - Plaid Hat/Merry Christmas Sign / Style B Snowman
+16
Christmas Hanging Ornaments Santa Claus Snowman Reindeer Bear Plush Dolls Festive Tree Decorations Cloth Art Home Decor
$0.58-1.99
No MOQ
Christmas Curtain Tiebacks Plush Knitted Buckle Holders Santa Snowman Reindeer Elf Doll Festive Window Decorations
Christmas Curtain Tiebacks Plush Knitted Buckle Holders Santa Snowman Reindeer Elf Doll Festive Window Decorations
like
Find Similar
Santa Claus plush curtain tieback in red and white knit fabric for Christmas decor - Santa Claus Curtain Buckle
Christmas reindeer curtain tieback with brown plush and red knitted sweater detail - Reindeer Curtain Buckle
Plush snowman christmas curtain tieback with striped scarf, size 46x14cm, 118g weight - Snowman Curtain Buckle
Christmas snowman curtain buckle with red scarf and black hat for holiday window decor - Horizontal Snowman
+16
Christmas Curtain Tiebacks Plush Knitted Buckle Holders Santa Snowman Reindeer Elf Doll Festive Window Decorations
-14%
$2.25-3.75
No MOQ
Christmas Curtain Tiebacks Plush Knitted Santa Snowman Reindeer Tie Back Buckle Holder Holiday Home Party Decor Cartoon
Christmas Curtain Tiebacks Plush Knitted Santa Snowman Reindeer Tie Back Buckle Holder Holiday Home Party Decor Cartoon
like
Find Similar
Christmas snowman curtain buckle with red scarf and black hat for holiday window decor - Horizontal Snowman
Plush Christmas reindeer curtain tieback with a striped scarf on dark blue drapes - Horizontal Reindeer
Pink Christmas elf doll with sequin hat and scarf, 36cm height for window decoration - Pink with Gold Ball Sequin Hat
Santa Claus curtain tie-back with green plaid hat and festive ornaments for home decor - High Hat Santa Claus
+16
Christmas Curtain Tiebacks Plush Knitted Santa Snowman Reindeer Tie Back Buckle Holder Holiday Home Party Decor Cartoon
-19%
$2.14-3.56
No MOQ
Christmas LED Headband Santa Claus Snowman Reindeer Glowing Hair Hoop Party Decoration Kids Adults Plush
Christmas LED Headband Santa Claus Snowman Reindeer Glowing Hair Hoop Party Decoration Kids Adults Plush
like
Find Similar
Glowing Christmas headband with LED Santa Claus heads in red and white festive felt - Velvet Luminous Santa Claus
Glow Christmas headband with red snowman figurines and LED light for holiday party decoration - Velvet Luminous Snowman
LED light-up Christmas headband with two glowing Santa Claus figures on a red band - Colorful Luminous Santa Claus
Luminous snowman headband with purple glitter hats and colorful LED lights for Christmas - Colorful Luminous Snowman
+16
Christmas LED Headband Santa Claus Snowman Reindeer Glowing Hair Hoop Party Decoration Kids Adults Plush
-5%
$0.47-0.99
Mix MOQ : 2
Christmas Snow Globe Lantern Vintage Bronze LED Light Musical Box Ornament Santa Snowman Micro Landscape Holiday Decoration
Christmas Snow Globe Lantern Vintage Bronze LED Light Musical Box Ornament Santa Snowman Micro Landscape Holiday Decoration
like
Find Similar
Vintage bronze Christmas snow globe lantern with snowman family and sparkling glitter - Snowman
Vintage bronze Christmas lantern with Santa scene and festive decorative lighting - Christmas Tree
Bronze vintage Christmas lantern snow globe with Santa and Christmas tree figures - Santa Claus
Vintage bronze Christmas lantern music box with Holy Family scene and sparkling glitter - Nativity Scene
Christmas Snow Globe Lantern Vintage Bronze LED Light Musical Box Ornament Santa Snowman Micro Landscape Holiday Decoration
$13.83
No MOQ
 · 
64 views
Christmas Cartoon Gel Pens Snowman Tree Hat Glove Silicone Plastic Needle Tip Cute Holiday Gift Stationery
Christmas Cartoon Gel Pens Snowman Tree Hat Glove Silicone Plastic Needle Tip Cute Holiday Gift Stationery
like
Find Similar
White gel pen featuring a cute snowman topper with a red scarf for Christmas gifts - White Snowman
Cute green Christmas tree gel pen with star topper on a clean stationery background - Green Christmas Tree
Red Christmas gel pen featuring a mini glove topper with a green bow and Best Wishes text - Red Christmas Glove
Cute red Christmas neutral pen with a 3D silicone Santa hat cap on grey desk - Red Christmas Hat
Christmas Cartoon Gel Pens Snowman Tree Hat Glove Silicone Plastic Needle Tip Cute Holiday Gift Stationery
$0.14
Mix MOQ : 2
 · 
58 sold recently
Christmas DIY Face Stickers Santa Reindeer Snowman Elf Penguin Paper Craft Puzzle Holiday Party Decoration Activity
Christmas DIY Face Stickers Santa Reindeer Snowman Elf Penguin Paper Craft Puzzle Holiday Party Decoration Activity
like
Find Similar
Detail view of 6 DIY Christmas face-changing stickers featuring Santa, deer and penguin - Christmas Make-A-Face Stickers (6 Sheets/Pack)
Christmas DIY Face Stickers Santa Reindeer Snowman Elf Penguin Paper Craft Puzzle Holiday Party Decoration Activity
$0.11
Mix MOQ : 5
 · 
84 sold recently
3D Christmas Pop Up Greeting Cards Honeycomb Paper Ball Santa Claus Reindeer Snowman Holiday Gift With Envelopes Stickers
3D Christmas Pop Up Greeting Cards Honeycomb Paper Ball Santa Claus Reindeer Snowman Holiday Gift With Envelopes Stickers
like
Find Similar
3D Christmas card set featuring pink snow scene, honeycomb gift box, and red envelope - Style A (Pink Gift Box)
3D pop-up Christmas tree card set with red envelope and gold sticker seal - Style B (Blue Christmas Tree)
3D snowman Christmas card set with red envelope and festive honeycomb paper details - Style C (Yellow Snowman)
Style D 3D Christmas card set with red honeycomb Santa nose and matching envelope - Style D (Red Santa Claus)
+3
3D Christmas Pop Up Greeting Cards Honeycomb Paper Ball Santa Claus Reindeer Snowman Holiday Gift With Envelopes Stickers
-5%
$0.82-4.93
No MOQ
Christmas Slap Bracelets Plush Slap Bands With LED Light Reindeer Santa Claus Snowman Pattern Festive Party Accessories For Kids
Christmas Slap Bracelets Plush Slap Bands With LED Light Reindeer Santa Claus Snowman Pattern Festive Party Accessories For Kids
like
Find Similar
Close-up of glowing white bear Christmas slap bracelet with LED lights on wrist - Christmas Bear Style (With Light) / Red
Detail of plush elk slap bracelet on wrist with warm Christmas bokeh lights background - Plush Reindeer Style / Brown
Detailed embroidery on green plush Christmas tree wristband with colorful ornaments - Plush Christmas Tree Style / Green
Close-up of plush Santa Claus snap bracelet with soft red fabric and festive embroidery - Plush Santa Claus Style / Red
+11
Christmas Slap Bracelets Plush Slap Bands With LED Light Reindeer Santa Claus Snowman Pattern Festive Party Accessories For Kids
-6%
$0.33-2.01
No MOQ
Free Shipping
Christmas Glowing Wooden Cabin LED Light Up Snowman Santa Ornament Hanging Xmas Holiday Decoration
Christmas Glowing Wooden Cabin LED Light Up Snowman Santa Ornament Hanging Xmas Holiday Decoration
like
Find Similar
Luminous Christmas wooden house ornament with red roof and warm LED light decoration - Reindeer Wood Cabin
Christmas Glowing Wooden Cabin LED Light Up Snowman Santa Ornament Hanging Xmas Holiday Decoration
$1.15
No MOQ
Christmas Stainless Steel Enamel Santa Claus Reindeer Snowman Tree Pendant Necklace For Women Festive Holiday Fashion Jewelry
Christmas Stainless Steel Enamel Santa Claus Reindeer Snowman Tree Pendant Necklace For Women Festive Holiday Fashion Jewelry
like
Find Similar
Golden stainless steel Santa Claus pendant necklace with size details on white background - Santa Claus Style (G1)
Golden stainless steel Christmas tree pendant necklace for women on a clean white background - Christmas Tree Style (G2)
Golden stainless steel Santa Claus pendant necklace with detailed size and weight specs - Santa Claus Style (G3)
Golden stainless steel necklace featuring a gingerbread man pendant for Christmas - Gingerbread Man Style (G4)
+25
Christmas Stainless Steel Enamel Santa Claus Reindeer Snowman Tree Pendant Necklace For Women Festive Holiday Fashion Jewelry
$2.44
No MOQ
 · 
10 sold recently
Free Shipping
Christmas Wine Bottle Stopper Metal Santa Claus Snowman Decorative Beverage Stopper With Rubber Gasket Festive Party Supplies
Christmas Wine Bottle Stopper Metal Santa Claus Snowman Decorative Beverage Stopper With Rubber Gasket Festive Party Supplies
like
Find Similar
Christmas wine bottle stopper featuring a cartoon Santa Claus with a festive tree - Santa Holding Christmas Tree
Santa Claus wine bottle stopper with stainless steel base and silicone seal ring - Santa Holding Gift Bag
Christmas Santa wine stopper with blue gift box and durable stainless steel cone - Santa With Blue Gift Box
Christmas wine stopper featuring a Santa Claus figure with durable rubber seals - Santa Playing Golden Horn
+12
Christmas Wine Bottle Stopper Metal Santa Claus Snowman Decorative Beverage Stopper With Rubber Gasket Festive Party Supplies
$0.98-1.28
No MOQ
 · 
458 sold recently
Christmas Bucket Hat Santa Claus Reindeer Snowman Print Foldable Holiday Fisherman Hat Outdoor Sun Hat For Men Women Gift
Christmas Bucket Hat Santa Claus Reindeer Snowman Print Foldable Holiday Fisherman Hat Outdoor Sun Hat For Men Women Gift
like
Find Similar
Festive red bucket hat featuring Santa Claus illustration and Merry Christmas text print - One Size / Gradient Red Santa Claus (13#)
Black Christmas bucket hat with festive spirit print including cocktails and candy canes - One Size / Black Christmas Spirit (14#)
Green Christmas bucket hat with happy holidays print featuring snowmen and Santa Claus - One Size / Emerald Green Happy Holidays (15#)
Christmas fisherman hat with holiday elf and gift box prints on brown lattice pattern - One Size / Tan Christmas Elf (16#)
+12
Christmas Bucket Hat Santa Claus Reindeer Snowman Print Foldable Holiday Fisherman Hat Outdoor Sun Hat For Men Women Gift
$2.65
No MOQ
Christmas Tree Hanging Ornaments Wool Felt Knitted Balls Snowman Gingerbread Man Snowflakes Nordic Holiday Home Decor
Christmas Tree Hanging Ornaments Wool Felt Knitted Balls Snowman Gingerbread Man Snowflakes Nordic Holiday Home Decor
like
Find Similar
Set of 6 Christmas wool felt balls 5cm with snowflake and gingerbread patterns in a box - 5cm Felt Balls Style A (6 Pcs Set)
Red knitted Christmas tree ball with white jacquard pattern on a white tray - 5cm Plush Ball 01 (1 Pc)
Handmade red and green striped knit Christmas ball ornament on a white porcelain plate - 5cm Plush Ball 02 (1 Pc)
Pink knitted Christmas tree ball ornament with white animal jacquard on a white plate - 5cm Plush Ball 03 (1 Pc)
+8
Christmas Tree Hanging Ornaments Wool Felt Knitted Balls Snowman Gingerbread Man Snowflakes Nordic Holiday Home Decor
$1.01-8.30
Mix MOQ : 5
Free Shipping
Christmas Plush Ornaments Hanging Dolls Santa Snowman Reindeer Bear Fabric Nordic Style Holiday Xmas Tree Decor
Christmas Plush Ornaments Hanging Dolls Santa Snowman Reindeer Bear Fabric Nordic Style Holiday Xmas Tree Decor
like
Find Similar
Christmas Santa Claus plush hanging ornament with red plaid fabric and snowflake button - Santa Claus Style A
Christmas snowman plush ornament in red white plaid fabric with a gold hanging string - Snowman Type A
Christmas reindeer plush ornament with red scarf, plaid fabric details, and gold hanging cord - Reindeer Style A
Christmas plush brown bear hanging ornament with red plaid hat and snowflake button detail - Bear Style A
+4
Christmas Plush Ornaments Hanging Dolls Santa Snowman Reindeer Bear Fabric Nordic Style Holiday Xmas Tree Decor
$0.58
Mix MOQ : 2
Christmas Snowman Magnetic Refrigerator Stickers DIY Cartoon Holiday Decoration Fridge Garage Door Waterproof
Christmas Snowman Magnetic Refrigerator Stickers DIY Cartoon Holiday Decoration Fridge Garage Door Waterproof
like
Find Similar
Detailed view of DIY snowman magnet set with 24 inch dimensions for holiday decor - 24x24 in / CT001 Magnetic Fridge Magnet
Detailed dimensions of 21x22 inch cartoon snowman magnetic sticker for Christmas decor - 21x22 in / CT003 Magnetic Fridge Magnet
Detailed size chart of magnetic snowman stickers with hat, scarf and carrot nose components - 25x10 in / CT004 Magnetic Fridge Magnet
Detailed size chart for Christmas snowman magnetic fridge stickers with dimensions in cm - 67x50 cm / CT030 Magnetic Fridge Magnet
+4
Christmas Snowman Magnetic Refrigerator Stickers DIY Cartoon Holiday Decoration Fridge Garage Door Waterproof
-5%
$2.46
No MOQ
 · 
18 sold recently
Christmas Headband Decorations Xmas Tree Snowman Tinsel Hair Hoop Elk Snowflake Gingerbread Man For Xmas Holiday Party Favors
Christmas Headband Decorations Xmas Tree Snowman Tinsel Hair Hoop Elk Snowflake Gingerbread Man For Xmas Holiday Party Favors
like
Find Similar
Christmas headband dimensions and weight featuring red socks and festive green tinsel - Bell Christmas Sock Style
Christmas headband dimensions detail showing 25cm height and 22cm width on white background - Snowflake Christmas Hat Style
Detailed dimensions and weight of Christmas headband with tinsel, berries and bells - Bell Star Style
Detailed size chart for Christmas headband featuring dimensions and weight information - Christmas Tree Ball Style
+11
NewChristmas Headband Decorations Xmas Tree Snowman Tinsel Hair Hoop Elk Snowflake Gingerbread Man For Xmas Holiday Party Favors
$0.78-1.33
No MOQ
Festive Christmas Brooch Zinc Alloy Rhinestone Enamel Santa Claus Snowman Christmas Tree Reindeer Pin For Women Men Jewelry
Festive Christmas Brooch Zinc Alloy Rhinestone Enamel Santa Claus Snowman Christmas Tree Reindeer Pin For Women Men Jewelry
like
Find Similar
Christmas tree brooch pin in green enamel with colorful crystals and golden base - 2075 Christmas Tree
Skiing snowman Christmas brooch in alloy with colorful enamel and sparkling rhinestones - 2074 Skiing Snowman
Golden Christmas tree brooch with colorful rhinestones on festive pine background - 2184 Christmas Tree
Sparkling Santa in Christmas stocking brooch with red rhinestones and enamel finish - 2346-Red Santa Claus
+2
Festive Christmas Brooch Zinc Alloy Rhinestone Enamel Santa Claus Snowman Christmas Tree Reindeer Pin For Women Men Jewelry
-9%
$1.05-1.78
No MOQ
 · 
20 views
Free Shipping
Artificial Fur Snowman Ball Keychain Cute Cartoon Christmas Bag Pendant With Alloy Ring Leather Patch Winter Gift Accessories
Artificial Fur Snowman Ball Keychain Cute Cartoon Christmas Bag Pendant With Alloy Ring Leather Patch Winter Gift Accessories
like
Find Similar
Plush Christmas snowman keychain with white faux fur pompom and golden keyring - White
Detail of red snowman faux fur pompom keychain with black leather and golden metal clasp - Red
Detail of red faux fur pompom snowman keychain with golden metal clasp and leather elements - Burgundy
Detail of plush snowman keychain with faux fur pompom and golden lobster clasp closure - Khaki
+15
Artificial Fur Snowman Ball Keychain Cute Cartoon Christmas Bag Pendant With Alloy Ring Leather Patch Winter Gift Accessories
-8%
$0.84
No MOQ
Miniature Christmas Tinplate Suitcase Candy Box Santa Snowman Metal Gift Box Portable Small Storage Box Holiday Decoration
Miniature Christmas Tinplate Suitcase Candy Box Santa Snowman Metal Gift Box Portable Small Storage Box Holiday Decoration
like
Find Similar
Mini red Christmas tin suitcase with Santa motif and silver handle for holiday candies - Mini Tinplate Suitcase Style A / Red Santa Claus
Christmas tin gift bag in forest green featuring Santa Claus and a metal handle - Mini Tinplate Suitcase Style B / Forest Green Santa Claus
Christmas tin candy box in dark green handbag style with Santa Claus and metal handle - Mini Tinplate Suitcase Style C / Dark Green Gift Illustration
Christmas tinplate candy gift box with Santa Claus print and silver metal handle - Mini Tinplate Suitcase Style D / Red Christmas Quotes
+2
Miniature Christmas Tinplate Suitcase Candy Box Santa Snowman Metal Gift Box Portable Small Storage Box Holiday Decoration
$1.10
No MOQ
Christmas 10-Color Ballpoint Pen With 3D Cartoon Topper Santa Snowman Reindeer Plastic Multi-Color Retractable Stationery Gift
Christmas 10-Color Ballpoint Pen With 3D Cartoon Topper Santa Snowman Reindeer Plastic Multi-Color Retractable Stationery Gift
like
Find Similar
Christmas 10-color shuttle pen with Santa topper and snowflake red barrel for kids - Santa Claus
Multicolor Christmas snowman ballpoint pen with 10 colors and light blue body design - Snowman
Christmas cartoon reindeer 10-color retractable ballpoint pen with 3D elk topper decoration - Elk
Christmas tree themed ten-color ballpoint pen with green barrel and festive 3D topper - Christmas Tree
Christmas 10-Color Ballpoint Pen With 3D Cartoon Topper Santa Snowman Reindeer Plastic Multi-Color Retractable Stationery Gift
-4%
$0.47
No MOQ
 · 
16 sold recently
Christmas Magnetic Wooden Poster Hanger Frame Wall Art Canvas Scroll Snowman Santa Claus Holiday Decor For Home
Christmas Magnetic Wooden Poster Hanger Frame Wall Art Canvas Scroll Snowman Santa Claus Holiday Decor For Home
like
Find Similar
Detail of Christmas wall art with wooden magnetic frame and festive snowman illustration - 21cm / White
Magnetic wood frame poster hanger with Merry Christmas tree and snowman illustration - 21cm / Black
Detail of wooden magnetic hanger frame with Merry Christmas festive illustration - 21cm / Oak
Magnetic wooden frame with Christmas tree and snowman canvas print for holiday wall decor - 21cm / Teak Wood Color
+16
Christmas Magnetic Wooden Poster Hanger Frame Wall Art Canvas Scroll Snowman Santa Claus Holiday Decor For Home
$1.59-3.54
Mix MOQ : 2
Christmas Window Clings PVC Static Cling Reindeer Snowman Bell Decals For Shop Glass Door Home Holiday Decor
Christmas Window Clings PVC Static Cling Reindeer Snowman Bell Decals For Shop Glass Door Home Holiday Decor
like
Find Similar
Christmas reindeer and bells static window stickers with multi-size specifications - Small / P-SD481 (Reindeer)
Snowman Christmas static window sticker with size chart from small to oversize dimensions - Small / P-SD482 (Snowman)
Christmas window sticker size chart featuring bells and gingerbread man designs - Small / P-SD483 (Bells)
Christmas static window sticker size guide showing red bow designs from 30x40cm to 100x130cm - Small / P-SD484 (Holiday Ornament)
+16
Christmas Window Clings PVC Static Cling Reindeer Snowman Bell Decals For Shop Glass Door Home Holiday Decor
$2.07-23.34
Mix MOQ : 2
LED Christmas String Lights Warm White USB Battery Powered Window Curtain Icicle Light With Snowman Star Tree Pendants
LED Christmas String Lights Warm White USB Battery Powered Window Curtain Icicle Light With Snowman Star Tree Pendants
like
Find Similar
Christmas LED curtain lights with Santa hangings, warm white USB 8-mode remote control - USB Always-on / Christmas Assorted Styles
Christmas hanging LED window lights with Santa Claus snowflake and tree motifs - USB Always-on / Snowflake Christmas Tree Style
Hanging LED Christmas lights featuring Santa and reindeer star and tree motifs - USB Always-on / Star & Christmas Tree Style
Warm white LED snowflake curtain light featuring classic Santa Claus designs for holiday decor - USB Always-on / Snowflake Style
+16
LED Christmas String Lights Warm White USB Battery Powered Window Curtain Icicle Light With Snowman Star Tree Pendants
$12.39-14.12
No MOQ
Christmas Window Stickers Static Cling PVC Santa Claus Reindeer Snowman Snowflake Glass Decoration Double Sided Festive Decals
Christmas Window Stickers Static Cling PVC Santa Claus Reindeer Snowman Snowflake Glass Decoration Double Sided Festive Decals
like
Find Similar
White and green Christmas window decals featuring Santa, reindeer, and festive cabins - Set XC025+XC028+BQ143
White Christmas window decals with Santa, reindeer, and snowflakes for glass decoration - Set BQ144+XC027
White Christmas window static stickers featuring Santa, reindeer, and snowflakes patterns - Set XC026+XC027+XC028
Christmas window stickers featuring Santa, reindeer and snowflakes for festive glass decor - Set XC25+XC26+XC28+BQ143
+16
Christmas Window Stickers Static Cling PVC Santa Claus Reindeer Snowman Snowflake Glass Decoration Double Sided Festive Decals
$0.26-3.11
Mix MOQ : 2
Christmas Napkin Rings Alloy Enamel Rhinestone Reindeer Tree Snowman Fox Holiday Dining Table Decoration
Christmas Napkin Rings Alloy Enamel Rhinestone Reindeer Tree Snowman Fox Holiday Dining Table Decoration
like
Find Similar
Christmas napkin ring with colorful rhinestones, bell and bow design in gold metal finish - Christmas Bell Bow
Christmas wreath napkin ring with green leaves and gold reindeer for festive tables - Reindeer Wreath
Golden Christmas reindeer napkin ring with colorful rhinestones and size details - Christmas Reindeer
Creative Christmas nutcracker napkin ring with gold base, colorful enamel, and pearl detail - Christmas Elf
+10
Christmas Napkin Rings Alloy Enamel Rhinestone Reindeer Tree Snowman Fox Holiday Dining Table Decoration
$0.78-2.07
No MOQ
 · 
24 views
Free Shipping
Vintage Christmas Linen Pillowcases Winter Deer Snowman Illustration Decorative Cushion Covers For Sofa Home Decor Square
Vintage Christmas Linen Pillowcases Winter Deer Snowman Illustration Decorative Cushion Covers For Sofa Home Decor Square
like
Find Similar
Detailed texture of linen pillowcase with winter snowman and forest animals print - 45x45cm / Snowman and Forest Animals Style (7)
Linen pillowcase with watercolor forest deer and rabbit on a grey sofa background - 45x45cm / Watercolored Winter Forest Style (8)
Linen pillowcase detail showing cute rabbits and snowy winter scene on grey sofa - 45x45cm / Rabbits in Snow Style (10)
Linen pillowcase featuring a cartoon deer and forest animal gathering in winter snow - 45x45cm / Forest Animal Gathering Style (11)
+21
Vintage Christmas Linen Pillowcases Winter Deer Snowman Illustration Decorative Cushion Covers For Sofa Home Decor Square
$1.21
No MOQ
Christmas LED Candle Light Snow Globe Santa Snowman Ornament Glitter Water Flameless Night Light Holiday Decor Plastic
Christmas LED Candle Light Snow Globe Santa Snowman Ornament Glitter Water Flameless Night Light Holiday Decor Plastic
like
Find Similar
Christmas candle lantern with snowman figure, silver base, and sparkling LED lights - Copper Wire Candle Snowman
Santa Claus crystal ball candle light with warm LED glowing for Christmas desk decor - Copper Wire Candle Santa Claus
Christmas snow globe candle light featuring Santa Claus and colorful glitter - Water-filled Snow Globe Santa Claus
LED Christmas candle lantern with Santa Claus figurine and bronze vintage base - Small Tall Candle Santa Claus
+6
Christmas LED Candle Light Snow Globe Santa Snowman Ornament Glitter Water Flameless Night Light Holiday Decor Plastic
$2.45-3.31
Mix MOQ : 2
 · 
21 views
Christmas Wine Bottle Covers Linen Burlap Bag Santa Snowman Reindeer Dolls Drawstring Festive Table Dinner Party Decor
Christmas Wine Bottle Covers Linen Burlap Bag Santa Snowman Reindeer Dolls Drawstring Festive Table Dinner Party Decor
like
Find Similar
Christmas snowman wine bottle cover made of red faux linen with drawstring closure - Snowman / Red
Green burlap Christmas wine bottle bag with Santa Claus and snowflake decorations - Santa Claus / Green
Christmas burlap wine bottle cover featuring snowman applique and drawstring closure - Snowman / Beige
Christmas burlap wine bottle cover featuring a 3D reindeer design and festive plaid details - Elk / Beige
Christmas Wine Bottle Covers Linen Burlap Bag Santa Snowman Reindeer Dolls Drawstring Festive Table Dinner Party Decor
$1.10
No MOQ
 · 
239 sold recently
Christmas Knitted Tote Bag Mini Handheld Polyester Winter Holiday Reindeer Snowman Pattern Cute Novelty Gift Bag
Christmas Knitted Tote Bag Mini Handheld Polyester Winter Holiday Reindeer Snowman Pattern Cute Novelty Gift Bag
like
Find Similar
Pink Christmas knit tote bag with snowman pattern and Merry Christmas text by fireplace - Cup Snowman / Pink Cup Snowman
Christmas themed knitted tote bag with Santa Claus design and Happy New Year text - Santa Claus / Red Santa Claus
Blue knit Christmas tote bag featuring a snowman design placed in front of a cozy fireplace - Snowman Blue / Blue Snowman
Close-up of a red Christmas knit tote bag showing white reindeer and snowflake patterns - Red White Deer / Red White Reindeer
Christmas Knitted Tote Bag Mini Handheld Polyester Winter Holiday Reindeer Snowman Pattern Cute Novelty Gift Bag
$1.96
No MOQ
 · 
11 sold recently
Christmas Throw Pillow Cover Peach Skin Velvet Square Digital Printed Holiday Home Decor Festive Snowman Pattern
Christmas Throw Pillow Cover Peach Skin Velvet Square Digital Printed Holiday Home Decor Festive Snowman Pattern
like
Find Similar
Christmas peach skin pillowcase with starfish tree and Season's Greetings text - Marine Christmas Tree (Season's Greetings)
Peach skin pillowcase featuring a marine Christmas wreath and Merry & Bright text - Marine Wreath (Merry & Bright)
Peach skin pillowcase featuring Noel ocean starfish and Christmas wreath pattern - Marine Patchwork (NOEL)
Peach skin pillowcase featuring coastal Christmas tree and seahorse on white background - Marine Creatures (PEACE)
+15
Christmas Throw Pillow Cover Peach Skin Velvet Square Digital Printed Holiday Home Decor Festive Snowman Pattern
-4%
$1.04
No MOQ
Christmas Chair Back Covers Cartoon Santa Snowman Reindeer Pattern Brushed Fabric Festive Dining Room Decor
Christmas Chair Back Covers Cartoon Santa Snowman Reindeer Pattern Brushed Fabric Festive Dining Room Decor
like
Find Similar
Christmas chair cover featuring snowman design with red finish and Let it Snow print - Red Snowman-Let it SNOW
Christmas chair cover featuring a green elf with XMAS banner, 50x60cm size - Green Gnome-XMAS
Christmas reindeer chair cover with JOY print and scarf, holiday decor, 50x60cm size - Reindeer-JOY
Christmas chair cover featuring Santa Claus motif with red and black plaid pattern - Red Santa-HO HO HO
+15
Christmas Chair Back Covers Cartoon Santa Snowman Reindeer Pattern Brushed Fabric Festive Dining Room Decor
$2.31-2.59
Mix MOQ : 2
Christmas Window Clings Double Sided Static Sticker PVC Santa Snowman Reindeer Snowflake Holiday Glass Decals
Christmas Window Clings Double Sided Static Sticker PVC Santa Snowman Reindeer Snowflake Holiday Glass Decals
like
Find Similar
Christmas window stickers with Santa, Reindeer and Gingerbread Man on glass - 2-Pack Combination BQ377+378
Christmas static window stickers set featuring Santa, snowman, reindeer and festive elf - 4-Pack Combination BQ(373-376)
Christmas window stickers featuring Santa, snowman and reindeer for holiday glass decoration - 4-Pack Combination BQ369+371+374+376
Christmas glass window decals featuring Santa, reindeer and snowman for holiday decoration - 4-Pack Combination BQ371+372+377+378
+15
Christmas Window Clings Double Sided Static Sticker PVC Santa Snowman Reindeer Snowflake Holiday Glass Decals
$0.26-1.64
Mix MOQ : 2
Christmas Window Stickers PVC Static Cling Decals Santa Claus Snowman Reindeer For Glass Door Shop Home Festive Decoration
Christmas Window Stickers PVC Static Cling Decals Santa Claus Snowman Reindeer For Glass Door Shop Home Festive Decoration
like
Find Similar
Merry Christmas window stickers featuring reindeer, snowman, and tree for glass decoration - 6251-Santa Claus Reindeer Set
Merry Christmas Santa and snowman window decals on a glass shop door background - 6252-Santa Polar Bear Train
Christmas Santa Claus window decal with snowman and Merry Christmas text decor - 6253-Welcome Santa Snowman Set
Christmas wreath window decals featuring Santa, snowman and reindeer for glass door decor - 6354-Christmas Hanging Decor Set
+15
Christmas Window Stickers PVC Static Cling Decals Santa Claus Snowman Reindeer For Glass Door Shop Home Festive Decoration
-4%
$0.85
No MOQ
Christmas Wreath Vine Fabric Plush Santa Snowman Reindeer Hanging Ornament Window Door Wall Festival Decoration
Christmas Wreath Vine Fabric Plush Santa Snowman Reindeer Hanging Ornament Window Door Wall Festival Decoration
like
Find Similar
30x40cm Rattan Christmas Wreath with Santa Claus Figure and Merry Christmas Sign - AGHH23-1 Long Leg Santa Claus
Christmas rattan wreath featuring a long-legged reindeer doll with white pine needles - AGHH23-2 Long Leg Reindeer
30cm Christmas rattan wreath featuring a red fabric Santa Claus and Merry Christmas sign - AGHH23-3 Lying Santa Claus
Christmas wreath with reindeer plush and Merry Christmas sign, size 30x3.5x32cm - AGHH23-5 Lying Reindeer
+15
Christmas Wreath Vine Fabric Plush Santa Snowman Reindeer Hanging Ornament Window Door Wall Festival Decoration
-5%
$8.16-16.37
No MOQ
Christmas Stockings Burlap Knitted 3D Santa Snowman Reindeer Gnome Embroidery Hanging Holiday Fireplace Decor Gift Bags
Christmas Stockings Burlap Knitted 3D Santa Snowman Reindeer Gnome Embroidery Hanging Holiday Fireplace Decor Gift Bags
like
Find Similar
Red and white knitted Christmas stocking with reindeer pattern and pom-poms hanging decor - Reindeer Sock
Knitted red and white wave pattern Christmas stocking with pom-poms on a wooden rack - White Stripe Sock
Knitted Christmas stocking with red, green and white zigzag pattern and colorful pom-poms - Green Stripe Sock
Linen Christmas stocking with Santa Claus motif and beige plush cuff decoration - Grey and White Santa Sock
+15
Christmas Stockings Burlap Knitted 3D Santa Snowman Reindeer Gnome Embroidery Hanging Holiday Fireplace Decor Gift Bags
$3.31-4.18
Mix MOQ : 2
Plush Christmas Hanging Ornaments Santa Snowman Reindeer Girl Dolls Xmas Tree Festive Home Party Holiday Decor
Plush Christmas Hanging Ornaments Santa Snowman Reindeer Girl Dolls Xmas Tree Festive Home Party Holiday Decor
like
Find Similar
Christmas plush elf doll ornament with red hat and white fur dress 16cm height - Santa Claus
Christmas reindeer plush pendant with white faux fur and red scarf for tree decoration - Elk
Christmas snowman plush pendant with red hat and scarf for holiday tree decoration - Snowman
Christmas plush girl doll hanging ornament with red hat and heart dress, 16cm height - Girls
Plush Christmas Hanging Ornaments Santa Snowman Reindeer Girl Dolls Xmas Tree Festive Home Party Holiday Decor
$1.84
Mix MOQ : 2
 · 
30 sold recently
Free Shipping
Christmas Candy Gift Boxes Pyramid Shape Paper Santa Snowman Reindeer Elf Holiday Party Favors Ribbon Decoration
Christmas Candy Gift Boxes Pyramid Shape Paper Santa Snowman Reindeer Elf Holiday Party Favors Ribbon Decoration
like
Find Similar
Triangle Christmas gift box with snowman pattern, red ribbon and Merry Christmas tag - Snowman Face
Pyramid Christmas candy box with cute elf face design and festive red ribbon bow - Elf / Boy Face
Pyramid Christmas Santa gift box with red ribbon and Merry Christmas tag on white background - Santa Claus Face
Brown reindeer pyramid Christmas gift box with white snow top and a red ribbon bow - Reindeer Face
Christmas Candy Gift Boxes Pyramid Shape Paper Santa Snowman Reindeer Elf Holiday Party Favors Ribbon Decoration
$0.09
Mix MOQ : 50
 · 
30 sold recently
Christmas Stocking Burlap 3D Santa Reindeer Snowman Bear Applique Hanging Gift Bag Holiday Home Party Decor
Christmas Stocking Burlap 3D Santa Reindeer Snowman Bear Applique Hanging Gift Bag Holiday Home Party Decor
like
Find Similar
Christmas stocking with reindeer plush and plaid trim hanging on a fireplace mantel - Medium Reindeer Style (Linen)
Detail of red fabric Christmas stocking with 3D teddy bear and snowflake on white fireplace - Medium Bear Style (Linen)
Linen Christmas stocking with snowman doll on a white mantelpiece for holiday decoration - Medium Snowman Style (Linen)
Detail of Christmas stocking with 3D teddy bear figure on white festive fireplace background - Medium Style A Dark Green Bear
+7
Christmas Stocking Burlap 3D Santa Reindeer Snowman Bear Applique Hanging Gift Bag Holiday Home Party Decor
-5%
$1.23
No MOQ
Christmas Plush Ornament Santa Snowman Reindeer Gingerbread Man Soft Fabric Pendant Xmas Tree Cute Cartoon Holiday Decor
Christmas Plush Ornament Santa Snowman Reindeer Gingerbread Man Soft Fabric Pendant Xmas Tree Cute Cartoon Holiday Decor
like
Find Similar
9cm yellow plush star ornament featuring an embroidered Santa Claus for festive decor - Star Santa Claus
Cute gingerbread man plush pendant with plaid bow and soft brown faux fur detail - Bow Tie Gingerbread Man
Plush Christmas reindeer donut ornament in red with gold sequin antlers, 11cm height - Reindeer Donut
Cute plush Santa Claus ornament 10cm tall with embroidery detail for holiday decor - Santa Claus
+7
Christmas Plush Ornament Santa Snowman Reindeer Gingerbread Man Soft Fabric Pendant Xmas Tree Cute Cartoon Holiday Decor
$0.63-0.81
Mix MOQ : 2
Christmas LED Lantern Retro Hanging Night Light Santa Snowman Desktop Ornament Plastic Battery Operated Holiday Decor
Christmas LED Lantern Retro Hanging Night Light Santa Snowman Desktop Ornament Plastic Battery Operated Holiday Decor
like
Find Similar
Red Christmas lantern with Santa Claus illustration and warm LED light on wooden base - Red Santa Claus
Close-up of a white Christmas lantern with a warm LED snowman scene on a rustic wood base - White Snowman
White Christmas lantern with elk forest scene and warm LED light on wooden base - White Reindeer
Close-up of white Christmas lantern with angel silhouette on a rustic wood base - White Angel
+7
Christmas LED Lantern Retro Hanging Night Light Santa Snowman Desktop Ornament Plastic Battery Operated Holiday Decor
$1.01
No MOQ
 · 
10 views
Christmas Holiday Headbands Reindeer Antlers Elf Hat Snowman Rabbit Ear Hair Hoop Festive Costume Accessories For Kids Adults
Christmas Holiday Headbands Reindeer Antlers Elf Hat Snowman Rabbit Ear Hair Hoop Festive Costume Accessories For Kids Adults
like
Find Similar
Detailed view of brown felt reindeer antler headband with festive golden bells - Style 01-Brown Antlers with Bells
Brown reindeer antler headband for Christmas party with colorful button decorations - Style 02-Antlers with Buttons Decoration
Cute plush Corgi ear muffs for Christmas party costumes and winter warmth for kids - Style 03-Cartoon Dog Head Earmuff Headband
Christmas headband with red spring balls and gold tinsel stars on a white background - Style 04-Spring Snowflake Star Headband
+7
Christmas Holiday Headbands Reindeer Antlers Elf Hat Snowman Rabbit Ear Hair Hoop Festive Costume Accessories For Kids Adults
$3.80-12.05
Mix MOQ : 3
Acrylic Christmas Cake Toppers Merry Christmas Hohoho Reindeer Snowman For Holiday Party Dessert Table Decoration
Acrylic Christmas Cake Toppers Merry Christmas Hohoho Reindeer Snowman For Holiday Party Dessert Table Decoration
like
Find Similar
White Merry Christmas acrylic cake topper with snowman design on a festive holiday cake - White Snowman
Macro view of red acrylic Merry Christmas cake topper with snowman detail for party decor - Christmas Red Snowman Style
Red acrylic Merry Christmas cake topper with festive tree and star elements - Christmas Red Tree Style
Macro shot of red Merry Christmas acrylic topper on a festive decorated holiday cake - Red Merry Christmas Style
+7
Acrylic Christmas Cake Toppers Merry Christmas Hohoho Reindeer Snowman For Holiday Party Dessert Table Decoration
$0.20-0.35
Mix MOQ : 10
Christmas Cushion Cover Peach Skin Decorative Pillowcase Holiday Party Reindeer Santa Snowman Square Soft Festive
Christmas Cushion Cover Peach Skin Decorative Pillowcase Holiday Party Reindeer Santa Snowman Square Soft Festive
like
Find Similar
Christmas polyester cushion cover with red tartan ampersand symbol on white background - Red Plaid & Symbol
White Christmas pillow case with COZY time red green plaid pattern text design - COZY time
Christmas polyester pillowcase with pixel-style Merry Christmas text in red and white - MERRY CHRISTMAS YA FILTHY ANIMAL
White polyester Christmas pillowcase with cute forest animals and Merry Christmas text - White Cartoon Forest Animals
+7
Christmas Cushion Cover Peach Skin Decorative Pillowcase Holiday Party Reindeer Santa Snowman Square Soft Festive
$1.24
Mix MOQ : 2
Christmas Hair Clips Resin Cartoon Santa Reindeer Snowman Alligator Clips For Kids Toddlers Baby Girls Holiday Party Accessory
Christmas Hair Clips Resin Cartoon Santa Reindeer Snowman Alligator Clips For Kids Toddlers Baby Girls Holiday Party Accessory
like
Find Similar
Pair of Christmas tree hair clips with green layers and red star on red ribbon base - Christmas Tree
Christmas hair clips set featuring red resin gift box charms with green ribbon wrap - Gift
Pair of kids red glove Christmas hair clips with Merry Christmas text and green ribbons - Christmas Sock
Set of 2 Christmas hair clips featuring yellow bells, red bows and green holly leaves - Bell
+7
Christmas Hair Clips Resin Cartoon Santa Reindeer Snowman Alligator Clips For Kids Toddlers Baby Girls Holiday Party Accessory
$0.24
Mix MOQ : 10
 · 
12 views
Christmas Appliance Handle Covers Burlap Refrigerator Oven Microwave Decorations Santa Snowman Reindeer Bear Festive
Christmas Appliance Handle Covers Burlap Refrigerator Oven Microwave Decorations Santa Snowman Reindeer Bear Festive
like
Find Similar
4-pack Christmas refrigerator handle covers with 3D Santa, reindeer, and snowman motifs - Style D Red Single Head 4-Piece Set
Christmas 4-piece red burlap appliance handle covers featuring Santa and reindeer designs - Style A Red Burlap Big Head 4-Piece Set
Christmas burlap refrigerator handle covers set of 4 with Santa Reindeer Snowman motifs - Style C Red Burlap Plaid 4-Piece Set
Christmas refrigerator handle covers with Santa and Snowman plush appliques in red linen - 8-Piece Set Red Long + Short
+7
Christmas Appliance Handle Covers Burlap Refrigerator Oven Microwave Decorations Santa Snowman Reindeer Bear Festive
$2.25-8.50
No MOQ
Christmas Headbands Felt Glitter Reindeer Antlers Snowman Santa Hat Bows Feathers Holiday Party Festive Decor
Christmas Headbands Felt Glitter Reindeer Antlers Snowman Santa Hat Bows Feathers Holiday Party Festive Decor
like
Find Similar
Christmas party headband with a red glitter top hat and festive decorations - Black Santa Hat Style
Red Christmas headband with glitter candy cane decor, measures 23.5cm by 22cm, weight 18.8g - Double Candy Cane Style
Christmas reindeer antler headband with brown glitter, white snowflakes and soft feathers - Snowflake Antler Feather Style
Festive Christmas snowman headband with red glitter hat and mittens, size 23x15cm - Gloves Snowman Style
+7
Christmas Headbands Felt Glitter Reindeer Antlers Snowman Santa Hat Bows Feathers Holiday Party Festive Decor
$0.63-1.01
Mix MOQ : 2
Christmas Resin Patch DIY Refrigerator Magnet Accessories Santa Claus Snowman Reindeer Flatback Decor For Holiday Crafts
Christmas Resin Patch DIY Refrigerator Magnet Accessories Santa Claus Snowman Reindeer Flatback Decor For Holiday Crafts
like
Find Similar
Macro detail of Christmas Santa resin flatback craft accessory with glitter, size 51x68mm - Large Bearded Santa Style (11#) / Without Magnet
Detailed 55x54mm Christmas snowman resin flatback charm for DIY crafts and magnets - Heart Snowman Style (3#) / Without Magnet
Christmas stocking resin ornament with glitter finish and Santa Claus detail 58x59mm - Stocking Santa Style (5#) / Without Magnet
Close-up of a cartoon Christmas reindeer resin charm with 53x66mm size detail - Running Reindeer Style (16#) / Without Magnet
+28
Christmas Resin Patch DIY Refrigerator Magnet Accessories Santa Claus Snowman Reindeer Flatback Decor For Holiday Crafts
$0.48-0.68
No MOQ
Cartoon Christmas Enamel Brooch Pin Alloy Santa Claus Reindeer Snowman Christmas Tree Badges For Holiday Party Gift Jewelry
Cartoon Christmas Enamel Brooch Pin Alloy Santa Claus Reindeer Snowman Christmas Tree Badges For Holiday Party Gift Jewelry
like
Find Similar
Green Christmas tree enamel brooch pin with dimensions 26mm x 20mm on white background - Christmas Tree
Cute Santa Claus enamel brooch pin with red and white finish 29mm x 24mm size - Santa Claus
Cartoon Santa Claus enamel brooch pin with dimensions 32mm by 17mm on white background - Standing Santa Claus
Cute Santa Claus enamel brooch with Merry Christmas lettering and holly berry details - Santa Banner
+2
Cartoon Christmas Enamel Brooch Pin Alloy Santa Claus Reindeer Snowman Christmas Tree Badges For Holiday Party Gift Jewelry
-8%
$0.34
Mix MOQ : 2
Free Shipping
Christmas Plush Doll Telescopic Long Legged Santa Snowman Reindeer Ornament Sequin Fabric Festive Home Decor Gift
Christmas Plush Doll Telescopic Long Legged Santa Snowman Reindeer Ornament Sequin Fabric Festive Home Decor Gift
like
Find Similar
Standing Santa Claus plush doll with telescopic legs and snowflake hat, height 60cm - Telescopic Santa Claus (Small)
Christmas snowman doll with red gold snowflake patterns and telescopic long striped legs - Telescopic Snowman (Small)
Red 55cm telescopic plush reindeer doll with Christmas hat and snowflake patterns - Telescopic Reindeer (Small)
Standing Christmas Santa plush doll in red and beige with gold stars, height 45cm - Short Leg Style (Santa Claus)
+2
Christmas Plush Doll Telescopic Long Legged Santa Snowman Reindeer Ornament Sequin Fabric Festive Home Decor Gift
-3%
$6.05-6.60
No MOQ
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access