Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Tablecloth Polyester Snowman Snowflake Print Rectangular Waterproof Festive Holiday Kitchen Dining Room Decor
Christmas Tablecloth Polyester Snowman Snowflake Print Rectangular Waterproof Festive Holiday Kitchen Dining Room Decor
like
Find Similar
Christmas snowman printed red polyester tablecloth with white snowflake festive holiday decor - 90*140cm / Red (XTC023)
Detail of Christmas snowman tablecloth featuring Let It Snow prints in festive dining room - 90*140cm / Black (XTC019)
Detail of Christmas snowman print polyester tablecloth with festive Let It Snow lettering - 90*140cm / Grey (XTC020)
Christmas snowman pattern tablecloth on wooden table with festive holiday background - 90*140cm / Black (XTC021)
+17
Christmas Tablecloth Polyester Snowman Snowflake Print Rectangular Waterproof Festive Holiday Kitchen Dining Room Decor
$3.23-7.80
Mix MOQ : 3
Christmas Decoration Kitchen Oven Mitts And Pot Holders Santa Claus Snowman Embroidered Fabric Cloth Festive Table Ornament
Christmas Decoration Kitchen Oven Mitts And Pot Holders Santa Claus Snowman Embroidered Fabric Cloth Festive Table Ornament
like
Find Similar
Christmas oven mitt with snowman embroidery on rustic wooden table with festive decor - Snowman Style Glove
Christmas Santa Claus oven mitt on wood table with pine branch holiday decoration - Santa Style Glove
Christmas place mat with Santa Claus and red bird embroidery on light wooden background - Santa Style Placemat
Christmas snowman heat insulation pad with red piping and embroidery on wood background - Snowman Style Placemat
Christmas Decoration Kitchen Oven Mitts And Pot Holders Santa Claus Snowman Embroidered Fabric Cloth Festive Table Ornament
-4%
$1.59-2.14
No MOQ
Christmas Hanging Ornaments Fabric Plush Santa Reindeer Snowman Bear Dolls Long Leg Festive Tree Decorations Rustic Home Decor
Christmas Hanging Ornaments Fabric Plush Santa Reindeer Snowman Bear Dolls Long Leg Festive Tree Decorations Rustic Home Decor
like
Find Similar
Detail of Santa Claus ornament with grey plaid hat and snowflake button hanging on wood - Santa Claus
Charming red and grey plaid snowman Christmas ornament hanging on a wooden frame - Snowman
Christmas plush teddy bear hanging decoration with red grey plaid and cozy festive lights - Bear Style
Christmas reindeer hanging ornament with grey plush outfit and red scarf for decor - Elk Style
Christmas Hanging Ornaments Fabric Plush Santa Reindeer Snowman Bear Dolls Long Leg Festive Tree Decorations Rustic Home Decor
-4%
$0.60
No MOQ
 · 
10 sold recently
Christmas Snowman Throw Pillow Case Decorative Square Peach Skin Fabric Digital Printing For Holiday Home Sofa Couch
Christmas Snowman Throw Pillow Case Decorative Square Peach Skin Fabric Digital Printing For Holiday Home Sofa Couch
like
Find Similar
Detail shot of Christmas snowman print on peach skin fabric decorative pillowcase - Black Top Hat Snowman Holding Gift Box (1)
Detail of soft peach skin pillowcase featuring a watercolor snowman with red hearts - Red Striped Hat Snowman Hearts Red Bird (2)
Detail of Christmas snowman and Santa Claus cartoon print on white square pillowcase - Snowman and Santa Hugging (3)
Close-up of peach skin pillowcase featuring a snowman with a cardinal bird and snowy village - Snowman Red Hat Red Bird Winter Night Scene (4)
+16
Christmas Snowman Throw Pillow Case Decorative Square Peach Skin Fabric Digital Printing For Holiday Home Sofa Couch
-4%
$1.04
No MOQ
Christmas Embroidered Patches For Clothing DIY Polyester Santa Claus Snowman Reindeer Christmas Tree Sew On Applique Patch
Christmas Embroidered Patches For Clothing DIY Polyester Santa Claus Snowman Reindeer Christmas Tree Sew On Applique Patch
like
Find Similar
Christmas tree embroidery patch with star and red trunk, size 5.2x4.2 cm variant - Christmas Tree Style (D)
Christmas Santa Claus embroidery patch style F with size 7.0 CM by 6.6 CM for DIY decor - Santa Claus Head Style (F)
Embroidered Santa Claus patch with Merry Christmas banner variant, size 7.5x6.8cm - Santa Claus Banner Style (E)
Christmas stocking embroidered patch with candy cane detail and size 8.0x5.5cm - Christmas Sock Gift Style (C)
+11
Christmas Embroidered Patches For Clothing DIY Polyester Santa Claus Snowman Reindeer Christmas Tree Sew On Applique Patch
-7%
$0.12-0.46
No MOQ
Free Shipping
Christmas Headband Set For Party Decorations Reindeer Snowman Christmas Tree Santa Hat Snowflake Pattern Glitter Tinsel Hair Hoop Festival Hair Accessories For Women Kids Xmas Gifts
Christmas Headband Set For Party Decorations Reindeer Snowman Christmas Tree Santa Hat Snowflake Pattern Glitter Tinsel Hair Hoop Festival Hair Accessories For Women Kids Xmas Gifts
like
Find Similar
Christmas headband with red stocking, glittery green leaf, and golden bell ornaments - Bell Christmas Sock Style
Christmas headband with red base and three Santa hats and silver snowflakes design - Snowflake Christmas Hat Style
Christmas headband with green tinsel, stars and gold glitter bells decoration - Bell Star Style
Christmas headband featuring a green glittery tree with white snowflake patterns - Christmas Tree Ball Style
+11
Christmas Headband Set For Party Decorations Reindeer Snowman Christmas Tree Santa Hat Snowflake Pattern Glitter Tinsel Hair Hoop Festival Hair Accessories For Women Kids Xmas Gifts
-5%
$0.77-1.31
Mix MOQ : 2
Christmas Tree Linen Pillowcase Merry Christmas Reindeer Snowman Print Decorative Square Cushion Cover For Sofa Home Decor
Christmas Tree Linen Pillowcase Merry Christmas Reindeer Snowman Print Decorative Square Cushion Cover For Sofa Home Decor
like
Find Similar
Red linen Christmas pillowcase with white Merry Christmas text tree on white background - Red Christmas Tree Lettering (YMDS3-1)
Linen Christmas tree pillow cover with colorful ornaments and gold star on blue background - Blue Green Gradient Decorated Tree (YMDS3-2)
Vintage Christmas linen pillowcase featuring tree, birds and floral postmark patterns - Vintage Letter Stamp Floral Christmas (YMDS3-3)
Linen Christmas tree pillowcase with red ornaments and warm string lights on white background - Blue Background Heart Decor Tree (YMDS3-4)
+12
Christmas Tree Linen Pillowcase Merry Christmas Reindeer Snowman Print Decorative Square Cushion Cover For Sofa Home Decor
-5%
$1.12
Mix MOQ : 2
Christmas Headbands Boppers Tinsel Reindeer Antlers Snowman Gingerbread Man For Holiday Party Glitter Plastic Felt Accessories
Christmas Headbands Boppers Tinsel Reindeer Antlers Snowman Gingerbread Man For Holiday Party Glitter Plastic Felt Accessories
like
Find Similar
Christmas headband with gold reindeer and green glitter tree on a red base - Elk Sleigh Style
Christmas headband with green tinsel tree, snowflake details and holly berry accents - 5 Christmas Trees Style
Red Christmas JOY headband with green glitter letters and mini holiday glove accents - JOY Glove Style
Christmas headband with red berries and silver glitter snowflakes showing dimensions - 5 Snowflakes Style
+13
NewChristmas Headbands Boppers Tinsel Reindeer Antlers Snowman Gingerbread Man For Holiday Party Glitter Plastic Felt Accessories
$0.81-1.38
Mix MOQ : 2
Christmas Throw Pillow Cover Linen Cotton Square Cartoon Reindeer Penguin Snowman Decor Case Winter Holiday Nordic Sofa Home
Christmas Throw Pillow Cover Linen Cotton Square Cartoon Reindeer Penguin Snowman Decor Case Winter Holiday Nordic Sofa Home
like
Find Similar
Detail of Christmas linen pillowcase with Believe in the Magic text and Santa graphics - Believe in the Magic Santa (1)
Detail of linen Christmas pillowcase with fox and tree pattern on gray sofa - Winter Frolic Fox (2)
Close-up of linen Christmas pillow cover with penguin tree and festive text on grey sofa - Baby It's Cold Outside Penguin (3)
Christmas linen pillowcase featuring a vintage winter moose design on a gray sofa - Winter Friends Moose (4)
+13
Christmas Throw Pillow Cover Linen Cotton Square Cartoon Reindeer Penguin Snowman Decor Case Winter Holiday Nordic Sofa Home
-4%
$1.18
No MOQ
Christmas Window Clings Static Stickers Double Sided Santa Claus Snowman Snowflakes Xmas Home Decor Glass Decals Novelty
Christmas Window Clings Static Stickers Double Sided Santa Claus Snowman Snowflakes Xmas Home Decor Glass Decals Novelty
like
Find Similar
9 sheets of Christmas static window stickers with snowman and reindeer patterns - Santa Claus Snowman Combination (A01)
Set of 9 double-sided pink Christmas window clings with Santa and Reindeer designs - Pink Christmas Penguin Gingerbread House (A02)
Detailed sheet of 9 Christmas window stickers featuring Santa Claus and reindeer designs - Classic Christmas Reindeer Elves (A03)
Close-up of 9-sheet Christmas cat window clings with snowflakes and balloon patterns - Red and Green Christmas Cat Series (A04)
+13
Christmas Window Clings Static Stickers Double Sided Santa Claus Snowman Snowflakes Xmas Home Decor Glass Decals Novelty
-5%
$2.19
No MOQ
Christmas Plush Doll Ornaments Santa Claus Snowman Reindeer Knit Felt Fabric Hanging Tree Decoration Desktop Display
Christmas Plush Doll Ornaments Santa Claus Snowman Reindeer Knit Felt Fabric Hanging Tree Decoration Desktop Display
like
Find Similar
Christmas snowman plush ornament hanging on a pine tree with warm knit textures - 12*15cm / Beige Snowman
Hanging plush Santa Claus doll with gold sequins and white faux fur Christmas decoration - 12*15cm / Beige Santa
Christmas reindeer plush ornament with silver scarf on a festive lit tree - 12*15cm / Beige Reindeer
Sequin Santa Claus plush doll with gold hat for Christmas home tabletop decoration - 16*22cm / Large Sitting Santa Claus
+13
Christmas Plush Doll Ornaments Santa Claus Snowman Reindeer Knit Felt Fabric Hanging Tree Decoration Desktop Display
$2.88-5.19
Mix MOQ : 10
Christmas Window Stickers PVC Static Cling Double Sided Reusable Cartoon Santa Snowman Reindeer For Holiday Party Decoration
Christmas Window Stickers PVC Static Cling Double Sided Reusable Cartoon Santa Snowman Reindeer For Holiday Party Decoration
like
Find Similar
Christmas window stickers featuring Santa, polar bear and reindeer in 20x30cm layout - BQ276
Christmas window decals set featuring Santa Claus and snowman motifs sized 20x30cm - BQ277 Santa Claus Gift Bag
Christmas window stickers set with Santa snowman and reindeer designs, 20x30cm size guide - BQ278 Santa Claus Gift Box
Christmas snowman window sticker set with white snowflakes and stars for party decoration - BQ279 Snowman
+13
Christmas Window Stickers PVC Static Cling Double Sided Reusable Cartoon Santa Snowman Reindeer For Holiday Party Decoration
$0.26-2.16
Mix MOQ : 2
Christmas Window Clings PVC Static Stickers Reindeer Snowman Snowflake Double Sided Reusable Glass Door Home Holiday Decor
Christmas Window Clings PVC Static Stickers Reindeer Snowman Snowflake Double Sided Reusable Glass Door Home Holiday Decor
like
Find Similar
Blue Christmas window clings set with white elk and snowflake static PVC stickers - BQ144 Reindeer
White Christmas reindeer bell static window stickers with snowflakes, size 20x30cm - BQ268 Bell & Sleigh
White Christmas tree and snowflake static window stickers, size 20x30cm for party decor - BQ269 Christmas Tree
Christmas reindeer and snowman window static sticker set for festive party decoration - BQ270 Snowman
+13
Christmas Window Clings PVC Static Stickers Reindeer Snowman Snowflake Double Sided Reusable Glass Door Home Holiday Decor
-4%
$0.25-2.07
Mix MOQ : 2
Christmas Party Glasses Plastic Glitter Snowman Elk Santa Claus Letter Holiday Photo Props Decor
Christmas Party Glasses Plastic Glitter Snowman Elk Santa Claus Letter Holiday Photo Props Decor
like
Find Similar
Christmas party glasses with red glitter frame, gold antlers and Santa Claus decoration - Reindeer Santa
Merry Christmas glitter party glasses with red and green lettering for festive celebrations - Christmas Letters Style
Red glitter Christmas party glasses with Happy New Year antlers and size dimensions - Happy New Year Letters
Red glitter Christmas elf glasses with striped candy canes and size dimensions - Candy Cane Elf
+13
Christmas Party Glasses Plastic Glitter Snowman Elk Santa Claus Letter Holiday Photo Props Decor
-3%
$0.30-0.74
No MOQ
Christmas Headband Tinsel Sequin Reindeer Snowman 2026 Festive Party Hair Accessories Holiday Ornament
Christmas Headband Tinsel Sequin Reindeer Snowman 2026 Festive Party Hair Accessories Holiday Ornament
like
Find Similar
Christmas headband dimensions and weight featuring red socks and festive green tinsel - Bell Christmas Sock Style
Christmas headband dimensions detail showing 25cm height and 22cm width on white background - Snowflake Christmas Hat Style
Detailed dimensions and weight of Christmas headband with tinsel, berries and bells - Bell Star Style
Detailed size chart for Christmas headband featuring dimensions and weight information - Christmas Tree Ball Style
+13
Christmas Headband Tinsel Sequin Reindeer Snowman 2026 Festive Party Hair Accessories Holiday Ornament
$0.81-1.38
Mix MOQ : 2
 · 
12 sold recently
Christmas Window Stickers Static PVC Double Sided Printing Santa Claus Snowman Reindeer Pattern Holiday Glass Decoration
Christmas Window Stickers Static PVC Double Sided Printing Santa Claus Snowman Reindeer Pattern Holiday Glass Decoration
like
Find Similar
9-sheet set of 3D Santa and snowman double-sided Christmas window static stickers - White 3D Santa 9-Sheet Set
9-piece set of snowman Christmas window clings featuring double-sided snowflake designs - Christmas Snowman 9-Sheet Set
9-piece set of Santa Claus 3D static window stickers with colorful festive cartoon designs - Colorful Santa with Gift Bag 9-Sheet Set
Christmas window cling set featuring Santa and snowflakes in a 9-sheet 20x30cm collection - White Santa Claus 9-Sheet Set
+13
Christmas Window Stickers Static PVC Double Sided Printing Santa Claus Snowman Reindeer Pattern Holiday Glass Decoration
-5%
$2.19
No MOQ
Slap Bracelets Plush Sequin Luminous Glow In Dark Christmas Halloween Party Favors For Kids Cartoon Santa Reindeer Snowman
Slap Bracelets Plush Sequin Luminous Glow In Dark Christmas Halloween Party Favors For Kids Cartoon Santa Reindeer Snowman
like
Find Similar
Christmas Santa Claus hair clip with red striped hat and white felt beard accessory - T1-25 Santa Claus (No Light)
Cute pink Christmas snowman snap bracelet with plaid hat and velvet plush decoration - T1-26 Snowman (No Light)
Cute reindeer slap bracelet with brown antlers and red bowknot for Christmas gifts - T1-27 Reindeer (No Light)
Cute plush Christmas slap bracelet featuring a white bear with blue striped hat and bow - T1-28 Bear (No Light)
+13
Slap Bracelets Plush Sequin Luminous Glow In Dark Christmas Halloween Party Favors For Kids Cartoon Santa Reindeer Snowman
-5%
$0.36-1.93
No MOQ
 · 
10 views
Christmas Pet Hair Clips Glitter Felt Bows Reindeer Antler Snowman Winter Theme Festive Party Decoration Headwear For Dogs Cats
Christmas Pet Hair Clips Glitter Felt Bows Reindeer Antler Snowman Winter Theme Festive Party Decoration Headwear For Dogs Cats
like
Find Similar
Sparkling red glitter Christmas bow hair clip with silver snowflake charm for pets and girls - Snowflake Red Bow
Sparkly Santa outfit bow hair clip with black boots and gold buckle for pets and kids - Santa Legs Bow
Sparkly Christmas dog bow hair clip with Santa hat and crown in festive red and green - Elf Hat Bow
Christmas reindeer bow hair clip in festive red glitter for cats and small dogs - Reindeer Antler Bow
+6
Christmas Pet Hair Clips Glitter Felt Bows Reindeer Antler Snowman Winter Theme Festive Party Decoration Headwear For Dogs Cats
-4%
$0.69
Mix MOQ : 2
Christmas Tree Hanging Ornaments Painted Plastic Snowman Santa Claus Train Car House Rocking Horse Retro Holiday Decor
Christmas Tree Hanging Ornaments Painted Plastic Snowman Santa Claus Train Car House Rocking Horse Retro Holiday Decor
like
Find Similar
Festive red plastic Christmas train ornament hanging on snow-covered tree branch - Train Engine (12*3.8*7cm)
Festive red vintage truck Christmas ornament with a mini snowman and snowy pine details - Vintage Truck (13*6.5*11cm)
Exquisite red house Christmas ornament with snowy white roof and festive gold hook - Small House (8*5*9.5cm)
Christmas rocking horse ornament with snowman pattern hanging on a festive snowy tree - Rocking Horse (10.5*3*11cm)
+6
Christmas Tree Hanging Ornaments Painted Plastic Snowman Santa Claus Train Car House Rocking Horse Retro Holiday Decor
$2.31-2.59
Mix MOQ : 10
Christmas Cookie Mold 3D Plastic Cartoon Reindeer Santa Snowman Tree Biscuit Cutter DIY Baking Tool Novelty
Christmas Cookie Mold 3D Plastic Cartoon Reindeer Santa Snowman Tree Biscuit Cutter DIY Baking Tool Novelty
like
Find Similar
3D Santa Claus and Snowman Christmas cookie cutter set with stampers for baking - E0823-Christmas 3-Piece Set
Cute cartoon bear cookie cutter with star pattern and matching yellow biscuit model - E0824-Bear
Japanese style Christmas cartoon cookie mold featuring a cute bell-wearing character - E0825-Reindeer A
White Christmas tree cookie cutter and finished golden biscuit with festive patterns - E0826-Christmas Tree
+6
Christmas Cookie Mold 3D Plastic Cartoon Reindeer Santa Snowman Tree Biscuit Cutter DIY Baking Tool Novelty
$1.33-2.82
Mix MOQ : 2
Free Shipping
Christmas Hair Claw Clips Cute Santa Claus Snowman Reindeer Tree Gingerbread Man Acrylic Glitter Hair Accessories For Holiday Party Women
Christmas Hair Claw Clips Cute Santa Claus Snowman Reindeer Tree Gingerbread Man Acrylic Glitter Hair Accessories For Holiday Party Women
like
Find Similar
Cute snowman hair claw clip in white acetate with red Santa hat for Christmas styling - Red Scarf Snowman
Cute snowman hair claw clip in acetate material with a festive Christmas design - Blue Scarf Snowman
Sparkly reindeer hair claw clip in brown and red glitter for Christmas hair styling - Elk
Glittery Santa Claus hair claw clip with red and silver sparkles for Christmas styling - Santa Claus
+8
Christmas Hair Claw Clips Cute Santa Claus Snowman Reindeer Tree Gingerbread Man Acrylic Glitter Hair Accessories For Holiday Party Women
$1.33
No MOQ
925 Sterling Silver Christmas Charms Enamel Snowman Santa Claus Snowflake Reindeer Bead For DIY Bracelet Jewelry Gifts
925 Sterling Silver Christmas Charms Enamel Snowman Santa Claus Snowflake Reindeer Bead For DIY Bracelet Jewelry Gifts
like
Find Similar
Christmas snowman charm in 925 sterling silver with colorful enamel details for bracelets - Snowman (BSC939)
S925 sterling silver Christmas polar bear charm with red gift box and blue gemstone - Polar Bear (BSC940)
S925 sterling silver Christmas charm with gingerbread man, snowflake and candy cane - Gingerbread Man Set (BSC941)
S925 sterling silver apple charm with red enamel dripping detail for DIY bracelets - Red Apple (SCC2644)
+4
925 Sterling Silver Christmas Charms Enamel Snowman Santa Claus Snowflake Reindeer Bead For DIY Bracelet Jewelry Gifts
-15%
$19.66-27.88
No MOQ
Free Shipping
Christmas Charms 14K Gold Plated Stainless Steel Enamel Cartoon Elk Tree Snowman Gingerbread Man DIY Jewelry Making Pendants
Christmas Charms 14K Gold Plated Stainless Steel Enamel Cartoon Elk Tree Snowman Gingerbread Man DIY Jewelry Making Pendants
like
Find Similar
Detail of 14K gold plated stainless steel reindeer charm showing 13.8mm x 8.8mm dimensions - Enamel Deer - Gold
14K gold-plated stainless steel rabbit pendant with red heart, size 11.4x15.7mm - Enamel Angel - Gold
14K gold plated stainless steel gingerbread man pendant charm with dimensions 16.4x12mm - Gingerbread Man - Gold
14K gold plated stainless steel gift box pendant charm with red dots and size measurements - Christmas Gift Bag - Gold
+2
Christmas Charms 14K Gold Plated Stainless Steel Enamel Cartoon Elk Tree Snowman Gingerbread Man DIY Jewelry Making Pendants
$1.01
No MOQ
 · 
28 sold recently
Free Shipping
Christmas Drop Earrings Alloy Enamel Snowman Santa Claus Asymmetric Pom Pom Jewelry With Stainless Steel Earring Post
Christmas Drop Earrings Alloy Enamel Snowman Santa Claus Asymmetric Pom Pom Jewelry With Stainless Steel Earring Post
like
Find Similar
Christmas star and holiday stocking asymmetric earrings with colorful crystal charms - Christmas Sock Combo Earrings
Asymmetric Christmas earrings featuring a snowman, green pompom and red Santa boot - Snowman Combo Earrings
Asymmetric Christmas earrings featuring gold stars, red pom-poms, and gift box charms - Gift Box Asymmetrical Earrings
Asymmetric Christmas earrings featuring red bows, stars, and enamel trees with plush balls - Christmas Tree Asymmetrical Earrings
+11
Christmas Drop Earrings Alloy Enamel Snowman Santa Claus Asymmetric Pom Pom Jewelry With Stainless Steel Earring Post
$0.79-1.18
Mix MOQ : 3
Free Shipping
Linen Plush Christmas Tree Hanging Pendants Santa Claus Snowman Reindeer Bear Dolls For Holiday Party Home Decoration
Linen Plush Christmas Tree Hanging Pendants Santa Claus Snowman Reindeer Bear Dolls For Holiday Party Home Decoration
like
Find Similar
Detail of Christmas Santa plush ornament with red green plaid hat and festive scene - Dancing Santa Claus Pendant
Detail of a Christmas snowman ornament with red burlap fabric and festive plush trimming - Dancing Snowman Pendant
Detail of plush reindeer Christmas ornament with red scarf on snowy festive background - Dancing Reindeer Pendant
Detail of plush Christmas bear ornament with red hat and scarf for tree decoration - Dancing Bear Pendant
+8
Linen Plush Christmas Tree Hanging Pendants Santa Claus Snowman Reindeer Bear Dolls For Holiday Party Home Decoration
$0.56
No MOQ
Christmas Gift Bags Kraft Paper Handheld Red Gold Stamping Reindeer Santa Snowman Patterns Holiday Party Favors
Christmas Gift Bags Kraft Paper Handheld Red Gold Stamping Reindeer Santa Snowman Patterns Holiday Party Favors
like
Find Similar
Detailed view of brown kraft Christmas gift bag with metallic red reindeer and white snowflakes - 025-1 Red Reindeer / 27x21x11cm
Close-up of brown kraft Christmas gift bag with a metallic red tree and snowflake pattern - 025-2 Christmas Tree / 27x21x11cm
Christmas kraft paper gift bag with snowman design and red glitter snowflakes - 025-3 Snowman / 27x21x11cm
Detail of kraft paper Christmas gift bag featuring red foil sled and snowflake patterns - 025-4 Sleigh / 27x21x11cm
+8
Christmas Gift Bags Kraft Paper Handheld Red Gold Stamping Reindeer Santa Snowman Patterns Holiday Party Favors
$0.19-0.24
Mix MOQ : 20
Christmas Enamel Brooch Pins Alloy Metal Santa Claus Snowman Xmas Tree Wreath Badge For Clothing Lapel Decoration
Christmas Enamel Brooch Pins Alloy Metal Santa Claus Snowman Xmas Tree Wreath Badge For Clothing Lapel Decoration
like
Find Similar
Cute cartoon Santa Claus enamel brooch pin with dimensions 31mm by 30mm for Christmas - Santa Claus
Christmas wreath enamel brooch with red bow and colorful ornaments, size 31mm x 31mm - Christmas Wreath
Cute enamel snowman brooch pin with size dimensions 37mm x 27mm and 4g weight - Snowman
Christmas tree metal brooch with colorful gift boxes and size specifications - Decorated Christmas Tree
+1
Christmas Enamel Brooch Pins Alloy Metal Santa Claus Snowman Xmas Tree Wreath Badge For Clothing Lapel Decoration
-9%
$0.39
Mix MOQ : 2
Free Shipping
Creative Cartoon Christmas Enamel Pin Brooch Zinc Alloy Santa Claus Gingerbread Man Pug Dog Snowman Festive Badge Jewelry
Creative Cartoon Christmas Enamel Pin Brooch Zinc Alloy Santa Claus Gingerbread Man Pug Dog Snowman Festive Badge Jewelry
like
Find Similar
Close-up of Christmas Pug enamel pin with green Xmas tree hat and vibrant colors - Pug with Christmas Tree Hat (QHXZ4599)
Detail of Christmas enamel pin featuring a cute dog in a red stocking with holly leaves - Pug in Christmas Stocking (QHXZ4600)
Close-up of pug enamel pin wearing reindeer antlers and red Christmas outfit - Pug with Reindeer Horns (QHXZ4601)
Christmas gingerbread style bow enamel pin with icing details and festive colorful dots - Gingerbread Bow (QHXZ4922)
+10
Creative Cartoon Christmas Enamel Pin Brooch Zinc Alloy Santa Claus Gingerbread Man Pug Dog Snowman Festive Badge Jewelry
-9%
$0.39-0.47
No MOQ
Free Shipping
Christmas Window Clings Static PVC Double Sided Snowflake Santa Snowman Reindeer Holiday Party Home Glass Decoration
Christmas Window Clings Static PVC Double Sided Snowflake Santa Snowman Reindeer Holiday Party Home Glass Decoration
like
Find Similar
Detailed sheet of 96 Christmas window stickers with Santa, reindeer and snowman decals - Set I (4 Sheets per Set/96 Pcs)
Detailed infographic of 6 Christmas static window stickers with sizing and 230 decals - Set J (6 Sheets per Set/230 Pcs)
Set of 8 double-sided static Christmas window clings with Santa and reindeer motifs - Set A (8 Sheets per Set/322 Pcs)
Detail of 8 sheets Christmas window stickers featuring reindeer, snowflakes and Santa Claus - Set B (8 Sheets per Set/339 Pcs)
+13
Christmas Window Clings Static PVC Double Sided Snowflake Santa Snowman Reindeer Holiday Party Home Glass Decoration
-5%
$0.96-2.33
No MOQ
Christmas Kids Socks Combed Cotton Non Slip Floor Socks With Plush Dolls Santa Reindeer Snowman Decor
Christmas Kids Socks Combed Cotton Non Slip Floor Socks With Plush Dolls Santa Reindeer Snowman Decor
like
Find Similar
Detail of white cotton knit baby sock with 3D snowman doll and anti-slip bottom - S (0-1 Years) / White (Snowman)
Detail of yellow kids socks with cute 3D Christmas plush shoes on wavy tray - S (0-1 Years) / Yellow (Boots)
Close-up of kids' beige ribbed mid-tube socks with 3D plush reindeer and non-slip soles - S (0-1 Years) / Light Khaki (Reindeer)
Detail of red Christmas kids socks featuring a Santa doll and vertical knit stripes - S (0-1 Years) / Red (Santa)
+6
Christmas Kids Socks Combed Cotton Non Slip Floor Socks With Plush Dolls Santa Reindeer Snowman Decor
$1.67
Mix MOQ : 3
Miniature Christmas Ornaments Santa Claus Snowman Resin Figurines Desktop Decoration Holiday Tabletop Micro Landscape Props
Miniature Christmas Ornaments Santa Claus Snowman Resin Figurines Desktop Decoration Holiday Tabletop Micro Landscape Props
like
Find Similar
Christmas resin Santa Claus desktop ornament Style 1 with star, size 4x5x6cm - Style 1 (Santa with Bag & Star)
Christmas Resin Santa Claus Figurine No. 3 holding a golden bell for desk decoration - Style 3 (Sitting Santa with Bell)
Resin Santa Claus figurine with green gift box, 5x4x7cm Christmas desk ornament - Style 4 (Santa with Green Gift)
Christmas Santa Claus figurine with green tree, resin ornament, No. 5, size 4x3x6cm - Style 5 (Santa with Small Tree)
+6
Miniature Christmas Ornaments Santa Claus Snowman Resin Figurines Desktop Decoration Holiday Tabletop Micro Landscape Props
-5%
$1.59-1.86
Mix MOQ : 2
Christmas Pet Necktie For Large Dogs Adjustable Elastic Strap Snowman Snowflake Pattern Festive Neckwear For Dogs Cats
Christmas Pet Necktie For Large Dogs Adjustable Elastic Strap Snowman Snowflake Pattern Festive Neckwear For Dogs Cats
like
Find Similar
Festive red Christmas tie for pets featuring green tree patterns and an elastic cord - Big Christmas Tree Leaf
Christmas dog tie with reindeer and snowflake patterns on a vibrant red background - Red Christmas Reindeer
Christmas dog tie with red and green chevron pattern and elastic neck strap accessory - Green Christmas Chevron
Detail of red and white striped pet Christmas tie with black elastic neck strap - Red Christmas Stripes
+6
Christmas Pet Necktie For Large Dogs Adjustable Elastic Strap Snowman Snowflake Pattern Festive Neckwear For Dogs Cats
$0.77
Mix MOQ : 10
 · 
10 views
Christmas Tree Ornaments Knitted Gnome Snowman Dolls Wooden Felt Hanging Pendant Nordic Winter Holiday Decor
Christmas Tree Ornaments Knitted Gnome Snowman Dolls Wooden Felt Hanging Pendant Nordic Winter Holiday Decor
like
Find Similar
Felt Christmas doll ornaments set with knitted hats and wooden beads for holiday tree decor - Style 1 (2 Pieces - White & Green)
Felt Christmas angel doll ornament with white knit hat and red striped sweater - Style 11 (1 Piece - Grey & White Striped Doll)
Felt snowman ornament in grey striped hat and skis, packaged for Christmas tree decor - Style 13 (1 Piece - Grey Skiing Girl)
Pink felt angel doll ornament with wooden skis in a clear gift display box - Style 12 (1 Piece - Pink Skiing Girl)
+6
Christmas Tree Ornaments Knitted Gnome Snowman Dolls Wooden Felt Hanging Pendant Nordic Winter Holiday Decor
$1.56-3.11
No MOQ
 · 
20 views
Free Shipping
Christmas Window Stickers Snowman Snowflake Static Cling PVC Double Sided Decals Glass Door Party Decor Winter Holiday Gift
Christmas Window Stickers Snowman Snowflake Static Cling PVC Double Sided Decals Glass Door Party Decor Winter Holiday Gift
like
Find Similar
Christmas snowman and snowflake static window stickers set with birds and holly, 20x30cm sheet - BQ392
Christmas snowman and snowflake static window sticker decals for festive winter decoration - BQ393
Christmas snowman window cling sticker with sizes for festive holiday home glass decoration - BQ394
Christmas snowman and snowflake window stickers set with Merry Christmas lettering - BQ395
+11
Christmas Window Stickers Snowman Snowflake Static Cling PVC Double Sided Decals Glass Door Party Decor Winter Holiday Gift
$0.26-2.16
Mix MOQ : 2
Christmas Wooden Hanging Ornaments Hand Painted Tree Decoration Pendants Reindeer Snowman Stocking Glove Holiday Home Decor
Christmas Wooden Hanging Ornaments Hand Painted Tree Decoration Pendants Reindeer Snowman Stocking Glove Holiday Home Decor
like
Find Similar
Style A wooden Christmas tag with Merry Christmas text and red polka dot bow - Style A
Handcrafted wooden reindeer ornament in gift sack with Happy Holidays greeting - Style B
Style C wooden Christmas tree pendant with Happy Holidays sled design and twine cord - Style C
Christmas snowman glove wooden ornament with I LOVE CHRISTMAS text and rustic rope - Style D
+11
Christmas Wooden Hanging Ornaments Hand Painted Tree Decoration Pendants Reindeer Snowman Stocking Glove Holiday Home Decor
-5%
$0.93-14.46
Mix MOQ : 6
Free Shipping
Women Christmas Embroidered Slouch Socks Cute Cartoon Santa Claus Snowman Reindeer Gingerbread Man Festive Mid-Calf Socks
Women Christmas Embroidered Slouch Socks Cute Cartoon Santa Claus Snowman Reindeer Gingerbread Man Festive Mid-Calf Socks
like
Find Similar
Women's red Christmas mid-tube cotton socks with white snowman and tree patterns - One Size / Red
Festive Christmas green crew socks featuring Santa Claus patterns and cute holiday polka dots - One Size / Green
Beige Christmas mid-calf cotton sock with reindeer and bell pattern on checkered background - One Size / White
Black Christmas cotton socks with gingerbread man patterns on festive background - One Size / Black
Women Christmas Embroidered Slouch Socks Cute Cartoon Santa Claus Snowman Reindeer Gingerbread Man Festive Mid-Calf Socks
$0.72
Mix MOQ : 20
 · 
11 views
Christmas Snowman Reindeer Animal Pillowcase Peach Skin Velvet Soft Decorative Cushion Cover Winter Holiday Home Decor
Christmas Snowman Reindeer Animal Pillowcase Peach Skin Velvet Soft Decorative Cushion Cover Winter Holiday Home Decor
like
Find Similar
Christmas reindeer and snowflake cushion cover in blue peach skin fabric for holiday decor - 18x18 Inch / Blue Reindeer Snow Scene (1)
Christmas peace dove pillowcase with winter landscape and snowflakes on blue backdrop - 18x18 Inch / Cyan Peace Dove Cabin (2)
Christmas cushion cover featuring polar bears and festive tree on soft peach skin fabric - 18x18 Inch / Polar Bear and Christmas Tree (3)
Christmas snowman and animal print peach skin square cushion cover with festive illustration - 18x18 Inch / Snowman Santa Stop Here (4)
+12
Christmas Snowman Reindeer Animal Pillowcase Peach Skin Velvet Soft Decorative Cushion Cover Winter Holiday Home Decor
-4%
$1.04
No MOQ
Christmas Pillow Case Peach Skin Velvet Cushion Cover Santa Snowman Elk Xmas Party Decor Home Living Room Sofa Decorative
Christmas Pillow Case Peach Skin Velvet Cushion Cover Santa Snowman Elk Xmas Party Decor Home Living Room Sofa Decorative
like
Find Similar
Peach skin christmas cushion cover with winter wreath, pine cones and festive birds - Cuddly Birds Wreath (TPR489-1)
Christmas peach skin pillowcase with hand-painted snowman and snowy house print - Snowy Cabin and Snowman (TPR489-2)
Peach skin pillowcase featuring festive Christmas tree and snowman oil painting print - Winter Snowy Town (TPR489-3)
Christmas peach skin pillowcase featuring a vintage white car and holiday gift boxes - White Vintage Car with Gifts (TPR489-4)
+12
Christmas Pillow Case Peach Skin Velvet Cushion Cover Santa Snowman Elk Xmas Party Decor Home Living Room Sofa Decorative
-4%
$1.10
No MOQ
Christmas Plush Scarf And Mittens Warm Faux Fur Neck Warmer Cartoon Snowman Winter Accessories For Women
Christmas Plush Scarf And Mittens Warm Faux Fur Neck Warmer Cartoon Snowman Winter Accessories For Women
like
Find Similar
Detail of plush leopard print scarf with cute cartoon character and soft faux fur texture - Dark Leopard Print Scarf
Detail of leopard print plush gloves featuring cute 3D cat head and woven fabric label - Light Leopard Print Gloves
Cute white plush mittens for women with red apple smiley face decoration and neck strap - Apple Pattern Gloves
Detail of white plush mittens with snowman patch, embroidery and lanyard design - Blue Snowman Mitten
+12
Christmas Plush Scarf And Mittens Warm Faux Fur Neck Warmer Cartoon Snowman Winter Accessories For Women
$2.59-3.75
No MOQ
Christmas Headbands Holiday Party Reindeer Antlers Santa Snowman Tree Glitter Sequins Festive Hair Accessories
Christmas Headbands Holiday Party Reindeer Antlers Santa Snowman Tree Glitter Sequins Festive Hair Accessories
like
Find Similar
Christmas snowman headband with red bow and white snowflake patterns for holiday party decor - Small Hand Red Hat Snowman Headband
Christmas headband with sparkly green trees and red velvet base, 21.5cm height - Green Snowflake Tree Headband
Detail of sequined reindeer antlers headband with festive green leaves and red berries - Multicolor Sequin Antlers
Detailed size chart showing 23cm height and 21cm width for the festive reindeer headband - Green Sequin Reindeer Antler
+12
Christmas Headbands Holiday Party Reindeer Antlers Santa Snowman Tree Glitter Sequins Festive Hair Accessories
-4%
$0.69
Mix MOQ : 2
Christmas Cushion Cover Pillowcase Soft Short Plush Digital Printed Cartoon Reindeer Snowman Watercolor Holiday Decorative
Christmas Cushion Cover Pillowcase Soft Short Plush Digital Printed Cartoon Reindeer Snowman Watercolor Holiday Decorative
like
Find Similar
Christmas pillowcase with watercolor steam train and holiday gifts illustration on white fabric - Christmas Train
Christmas pillowcase featuring Santa Claus driving a green steam train with gifts - Santa Claus Train
Christmas cushion cover featuring a 3D cartoon reindeer peeking through a brick wall - 3D Reindeer
Christmas pillowcase with 3D cartoon Santa Claus peeping through a brick wall - 3D Santa Claus
+12
Christmas Cushion Cover Pillowcase Soft Short Plush Digital Printed Cartoon Reindeer Snowman Watercolor Holiday Decorative
$1.30
Mix MOQ : 2
Christmas Cushion Cover Pink Watercolor Santa Snowman Short Plush Square Holiday Home Decor Soft Pillowcase
Christmas Cushion Cover Pink Watercolor Santa Snowman Short Plush Square Holiday Home Decor Soft Pillowcase
like
Find Similar
Christmas hot chocolate and gingerbread man printed cushion cover for holiday decor - Hot Chocolate Season
White Christmas pillowcase featuring pink vintage truck, snowman and 'Tis the Season text - Pink Truck and Snowman
White Christmas pillow cover featuring pink Santa Claus and Merry Christmas script - Santa Claus with Wreath
Detail showing pink watercolor Christmas trees and 'Tis the season to sparkle' text on pillowcase - Pink Christmas Trees
+12
Christmas Cushion Cover Pink Watercolor Santa Snowman Short Plush Square Holiday Home Decor Soft Pillowcase
$1.30
Mix MOQ : 2
Christmas Pillow Cover Linen Cushion Case Holiday Reindeer Snowman Print Festive Home Sofa Living Room Office Decoration
Christmas Pillow Cover Linen Cushion Case Holiday Reindeer Snowman Print Festive Home Sofa Living Room Office Decoration
like
Find Similar
Christmas snowman pillowcase in light pink linen with Let It Snow snowflake prints - Pink Snowman Let It Snow
Christmas snowman pillowcase with Merry Christmas text and festive linen texture - Beige Snowman Merry Christmas
Linen Christmas pillowcase with pink trees and jingle bells pattern for sofa decor - Pink Christmas Tree Jingle Bells
Pink Christmas pillowcase with reindeer and snowflakes design for holiday home decor - Pink Reindeer Merry Christmas
+12
Christmas Pillow Cover Linen Cushion Case Holiday Reindeer Snowman Print Festive Home Sofa Living Room Office Decoration
$1.30
Mix MOQ : 2
Christmas Party Glasses Glitter Plastic Costume Photo Props Santa Reindeer Snowman Decor For Adults Kids
Christmas Party Glasses Glitter Plastic Costume Photo Props Santa Reindeer Snowman Decor For Adults Kids
like
Find Similar
Christmas glasses with Santa Claus and candy cane motifs, 17.5cm x 11.5cm sparkling frame - Painted Santa Claus
Sparkly red snowman Christmas glasses for festive party dress-up and photos - Painted Snowman
Christmas bear themed decorative glasses with red frames and golden glitter details - Painted Bear
Christmas tree glasses featuring nutcracker soldier design and dimensional size details - Painted Christmas Tree
+12
Christmas Party Glasses Glitter Plastic Costume Photo Props Santa Reindeer Snowman Decor For Adults Kids
$0.72
Mix MOQ : 5
Christmas Cake Toppers Soft PVC Santa Claus Reindeer Snowman Merry Christmas Party Holiday Baking DIY Decorations
Christmas Cake Toppers Soft PVC Santa Claus Reindeer Snowman Merry Christmas Party Holiday Baking DIY Decorations
like
Find Similar
Cartoon reindeer soft silicone cake topper with red hat, size 3.6cm by 3.8cm - #6002 Cartoon Reindeer with Hat
Christmas cake topper featuring Santa and reindeer with Merry Christmas banner - #6007 Colorful Merry Christmas Banner with Friends
Christmas snowman cake topper with red cape and yellow earmuffs on a plastic stick - #6016 Snowman with Antler Headphones
Star-shaped yellow Christmas cake topper with red hat, size 3.6cm x 4cm for party decor - #6001 Smiling Star with Christmas Hat
+12
Christmas Cake Toppers Soft PVC Santa Claus Reindeer Snowman Merry Christmas Party Holiday Baking DIY Decorations
$0.20-0.30
Mix MOQ : 2
 · 
24 views
Christmas Snowman Hanging Ornament Acrylic Cartoon Tree Decoration Festive Holiday Home Decor Red White
Christmas Snowman Hanging Ornament Acrylic Cartoon Tree Decoration Festive Holiday Home Decor Red White
like
Find Similar
3D render of a cute cartoon snowman ornament hanging on a snowy branch with red hat - Cute Striped Hat Snowman (1)
Cute snowman Christmas tree ornament with red striped scarf hanging on snowy pine branch - Winter Snow Scene Snowman (2)
Cute cartoon snowman Christmas tree ornament hanging on a snowy pine branch in 3D style - Cute Carrot Nose Snowman (3)
Cute cartoon snowman Christmas tree ornament with red scarf and hat on snowy background - Red Knitted Hat Snowman (4)
+2
Christmas Snowman Hanging Ornament Acrylic Cartoon Tree Decoration Festive Holiday Home Decor Red White
$0.22-1.08
Mix MOQ : 2
 · 
11 views
Christmas Cake Decoration Accessories Cupcake Stand Toppers Liners For Dessert Party Celebration Festive Santa Snowman Reindeer Pattern
Christmas Cake Decoration Accessories Cupcake Stand Toppers Liners For Dessert Party Celebration Festive Santa Snowman Reindeer Pattern
like
Find Similar
Three-tier red Christmas cupcake display stand with a transparent cover and bow handle - Christmas Tower Red with Border Set
Pack of 50 natural brown greaseproof muffin paper cups with pleated edges, 7cm diameter - Oil-proof Cupcake Liners Natural Color 50pcs
Set of 50 white greaseproof paper baking cups, 7x5x4cm size for cupcakes and muffins - Oil-proof Cupcake Liners White 50pcs
50-pack of brown greaseproof paper muffin cups measuring 7x5x4cm with vertical ridges - Oil-proof Cupcake Liners Coffee Color 50pcs
+6
Christmas Cake Decoration Accessories Cupcake Stand Toppers Liners For Dessert Party Celebration Festive Santa Snowman Reindeer Pattern
$0.23-2.07
Mix MOQ : 3
 · 
10 views
Christmas Multicolor Ballpoint Pen With 3D Cartoon Santa Snowman Reindeer Topper Plastic Stationery Student Gift Novelty
Christmas Multicolor Ballpoint Pen With 3D Cartoon Santa Snowman Reindeer Topper Plastic Stationery Student Gift Novelty
like
Find Similar
Cartoon Santa Claus 10-color ballpoint pen for Christmas stationery and student gift - Santa Claus
Christmas snowman 10-color ballpoint pen with blue barrel and 3D festive topper - Snowman
Brown reindeer 10-color ballpoint pen for Christmas gifts on a white grid notebook - Deer
Detail of 10-color Christmas ballpoint pen featuring a green barrel and 3D Xmas tree topper - Christmas Tree
Christmas Multicolor Ballpoint Pen With 3D Cartoon Santa Snowman Reindeer Topper Plastic Stationery Student Gift Novelty
$0.49
No MOQ
Christmas LED Lantern Portable Retro Plastic Candle Light Santa Snowman Tabletop Hanging Decorative Night Light
Christmas LED Lantern Portable Retro Plastic Candle Light Santa Snowman Tabletop Hanging Decorative Night Light
like
Find Similar
White Christmas lantern with Santa Claus and LED candle light for holiday decor - Santa Claus / White Santa Claus
Detailed view of a white Christmas lantern featuring snowman and winter tree illustrations - Snowman / White Snowman
Red Christmas lantern with Santa Claus illustration and LED candle light for desk decoration - Santa Claus / Red Santa Claus
Detail of red Christmas lantern with snowman and tree micro landscape inside - Snowman / Red Snowman
Christmas LED Lantern Portable Retro Plastic Candle Light Santa Snowman Tabletop Hanging Decorative Night Light
$1.38
Mix MOQ : 2
 · 
15 views
LED Christmas Candle Lamp Water Lantern Santa Snowman Figures Retro Bronze Base Battery Operated Glitter Snow Light Holiday Decor
LED Christmas Candle Lamp Water Lantern Santa Snowman Figures Retro Bronze Base Battery Operated Glitter Snow Light Holiday Decor
like
Find Similar
Detail of Santa Claus and Christmas tree inside a lighted candle lamp with bronze base - Santa Claus
Close-up of vintage bronze Christmas lantern with snowman inside on festive red gift box - Snowman
Detailed view of a vintage gold Christmas candle lantern with an interior miniature tree - Christmas Tree
Detail of candle-shaped Christmas lantern with an angel figure and antique bronze base - Angel
LED Christmas Candle Lamp Water Lantern Santa Snowman Figures Retro Bronze Base Battery Operated Glitter Snow Light Holiday Decor
$3.17
No MOQ
Christmas Hanging Pendants Pink Knitted Hat Plush Santa Snowman Reindeer Girl Doll Ornaments Holiday Home Decor
Christmas Hanging Pendants Pink Knitted Hat Plush Santa Snowman Reindeer Girl Doll Ornaments Holiday Home Decor
like
Find Similar
Pink and white Christmas gnome ornament with knitted hat and golden boots - Pink Santa Claus Knit Hat Pendant
Pink and white plush Christmas snowman ornament with golden boots and white scarf - Pink Snowman Knit Hat Pendant
Pink plush Christmas angel ornament with white fur details and gold glitter boots - Pink Girl Knit Hat Pendant
Pink reindeer plush ornament with golden sequin antlers and feather skirt for Xmas tree - Pink Reindeer Knit Hat Pendant
Christmas Hanging Pendants Pink Knitted Hat Plush Santa Snowman Reindeer Girl Doll Ornaments Holiday Home Decor
-5%
$1.70
No MOQ
Free Shipping
Christmas 3D Acrylic LED Night Light Color Changing Desktop Decorative Lamp Snowman Santa Claus Tree Novelty Gift
Christmas 3D Acrylic LED Night Light Color Changing Desktop Decorative Lamp Snowman Santa Claus Tree Novelty Gift
like
Find Similar
3D acrylic Santa Claus night light with glowing blue lines on a white base for Christmas - Acrylic Santa Claus
Luminous 3D acrylic Christmas tree night light with colorful LED effects and base - Acrylic Christmas Tree
Colorful Eiffel Tower 3D LED night light with glowing acrylic base for home decor - Acrylic Eiffel Tower
Luminous LED 3D acrylic Christmas snowman night light with colorful glowing base - Acrylic Christmas Snowman
Christmas 3D Acrylic LED Night Light Color Changing Desktop Decorative Lamp Snowman Santa Claus Tree Novelty Gift
-4%
$0.41
Mix MOQ : 2
 · 
17 views
Snowman Stickers Waterproof PVC Cartoon Christmas Festive Laptop Luggage Decoration DIY Decals Cute Winter Theme
Snowman Stickers Waterproof PVC Cartoon Christmas Festive Laptop Luggage Decoration DIY Decals Cute Winter Theme
like
Find Similar
50pcs non-repeating waterproof snowman cartoon stickers for luggage and laptops - 50Pcs Snowman Patterns (Non-repetitive)
Snowman Stickers Waterproof PVC Cartoon Christmas Festive Laptop Luggage Decoration DIY Decals Cute Winter Theme
$0.98
No MOQ
 · 
16 views
Red Fabric Embroidery Chinese New Year Hair Clip Lucky Horse Koi Snowman Hair Ties Festive Headwear For Girls Women
Red Fabric Embroidery Chinese New Year Hair Clip Lucky Horse Koi Snowman Hair Ties Festive Headwear For Girls Women
like
Find Similar
Close-up of red fabric horse headpiece with blue embroidery and silver thread edging - Lucky Horse Hair Clip / Red
Detailed view of red embroidered pony hair tie with gold edging and floral patterns - Lucky Horse Hair Tie / Red
Detail of red and beige fabric pony charm with straw hat and embroidery decoration - Ingot Horse Hair Clip / Beige
Detail of embroidered horse hair tie with mini straw hat and tassel on elastic band - Ingot Horse Hair Tie / Beige
+8
Red Fabric Embroidery Chinese New Year Hair Clip Lucky Horse Koi Snowman Hair Ties Festive Headwear For Girls Women
-9%
$1.36-2.23
No MOQ
Free Shipping
Handmade Wool Felt Christmas Ball Ornaments Snowflake Snowman Gingerbread Man Decorative Hanging Balls For Holiday Tree Decor
Handmade Wool Felt Christmas Ball Ornaments Snowflake Snowman Gingerbread Man Decorative Hanging Balls For Holiday Tree Decor
like
Find Similar
Set of 6 Christmas wool felt decorative balls with snowflake patterns in a gift box - 5cm / Style A
6pcs Christmas wool felt balls with snowflake and tree patterns in 5cm gift box set - 5cm / Style B
Set of 6 red wool felt Christmas balls with white snowflake and tree patterns in a box - 5cm / Style C
6-piece set of red and white wool felt Christmas balls with snowflake and star patterns - 5cm / Style D
+4
NewHandmade Wool Felt Christmas Ball Ornaments Snowflake Snowman Gingerbread Man Decorative Hanging Balls For Holiday Tree Decor
$6.34-6.92
Mix MOQ : 2
Free Shipping
Vintage Christmas Linen Cushion Cover Santa Claus Snowman Elk Pattern Holiday Decoration Pillowcase No Insert
Vintage Christmas Linen Cushion Cover Santa Claus Snowman Elk Pattern Holiday Decoration Pillowcase No Insert
like
Find Similar
Macro shot of vintage linen Christmas pillow cover with Santa Claus watercolor print - 45x45cm Linen Single Side Without Core / Santa and Girl Illustration (DYM387-1)
Vintage Christmas pillow cover featuring Santa Claus and reindeer on linen texture - 45x45cm Linen Single Side Without Core / Santa and Elk with Gift Box (DYM387-2)
Vintage Christmas snowman pillow cover featuring gift boxes and pine cones on linen fabric - 45x45cm Linen Single Side Without Core / Snowman in Green Hat with Gifts (DYM387-3)
Close-up of two watercolor snowmen with hats and scarves on linen Christmas pillowcase - 45x45cm Linen Single Side Without Core / Two Standing Snowmen Illustration (DYM387-4)
+21
NewVintage Christmas Linen Cushion Cover Santa Claus Snowman Elk Pattern Holiday Decoration Pillowcase No Insert
$1.30
Mix MOQ : 2
Christmas DIY Make A Face Sticker Sheets For Kids Holiday Decorations Santa Snowman Reindeer Penguin Elf Gingerbread Man
Christmas DIY Make A Face Sticker Sheets For Kids Holiday Decorations Santa Snowman Reindeer Penguin Elf Gingerbread Man
like
Find Similar
Set of 6 Christmas DIY character stickers for kids featuring Santa Snowman and Reindeer - Christmas Series Set (Z124)
Christmas DIY Make A Face Sticker Sheets For Kids Holiday Decorations Santa Snowman Reindeer Penguin Elf Gingerbread Man
-5%
$0.49
No MOQ
Cotton Christmas Crew Socks Santa Claus Reindeer Snowman Pattern Mid Calf Knitted Holiday Stockings For Women Men Party Gift
Cotton Christmas Crew Socks Santa Claus Reindeer Snowman Pattern Mid Calf Knitted Holiday Stockings For Women Men Party Gift
like
Find Similar
Dark grey festive Christmas crew socks with white snowflake patterns and red heels - 37-43 / Gray
Festive red Christmas socks with reindeer and snowflake patterns in 1 pair pack - 37-43 / Three Deer Heads
Mint green snowman pattern Christmas holiday cotton socks with festive gift packaging - 37-43 / Snowman Santa
Christmas cotton socks with red and green patterns and Santa Claus motif with tag - 37-43 / Santa Claus Style 1
+11
Cotton Christmas Crew Socks Santa Claus Reindeer Snowman Pattern Mid Calf Knitted Holiday Stockings For Women Men Party Gift
$0.71
No MOQ
Blue Christmas Cushion Covers Linen Watercolor Santa Snowman Decorative Pillowcases For Living Room Sofa Home Decor
Blue Christmas Cushion Covers Linen Watercolor Santa Snowman Decorative Pillowcases For Living Room Sofa Home Decor
like
Find Similar
Detail of Christmas pillow cover with blue ornaments and Joy to the world print - Blue Christmas Ornaments-Joy to the World (23YM149-1)
Christmas snowman pillow cover with blue Santa Claus illustration and Joy text design - Blue Santa Claus-Joy (23YM149-2)
Detail of Christmas pillow cover with blue bells, watercolor flowers and Jingle slogan - Blue Bells-Jingle all the way (23YM149-4)
Detailed view of watercolor snowman print with Snow text on a square Christmas pillowcase - Blue Snowman-Snow (23YM149-3)
Blue Christmas Cushion Covers Linen Watercolor Santa Snowman Decorative Pillowcases For Living Room Sofa Home Decor
$1.15
Mix MOQ : 2
 · 
17 sold recently
Christmas Ornaments Resin Santa Snowman Gingerbread Man Gnome Cup Desktop Decor Cartoon Festive Holiday Gift
Christmas Ornaments Resin Santa Snowman Gingerbread Man Gnome Cup Desktop Decor Cartoon Festive Holiday Gift
like
Find Similar
Christmas resin snowman figurine in red heart cup with green scarf and candy cane decoration - Red Snowman Cup
Christmas gnome resin ornament featuring red striped hat and white beard on a ribbon base - White Gnome Cup
Christmas Santa figurine in pink mug resin ornament for festive tabletop decor - Pink Santa Claus Cup
Resin Christmas gingerbread man in red mug figurine decoration with heart pattern - Red Snowman Cup Model B
+1
Christmas Ornaments Resin Santa Snowman Gingerbread Man Gnome Cup Desktop Decor Cartoon Festive Holiday Gift
$4.84
No MOQ
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access