Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Plush Doll Telescopic Long Legged Santa Snowman Reindeer Ornament Sequin Fabric Festive Home Decor Gift
Christmas Plush Doll Telescopic Long Legged Santa Snowman Reindeer Ornament Sequin Fabric Festive Home Decor Gift
like
Find Similar
Standing Santa Claus plush doll with telescopic legs and snowflake hat, height 60cm - Telescopic Santa Claus (Small)
Christmas snowman doll with red gold snowflake patterns and telescopic long striped legs - Telescopic Snowman (Small)
Red 55cm telescopic plush reindeer doll with Christmas hat and snowflake patterns - Telescopic Reindeer (Small)
Standing Christmas Santa plush doll in red and beige with gold stars, height 45cm - Short Leg Style (Santa Claus)
+2
Christmas Plush Doll Telescopic Long Legged Santa Snowman Reindeer Ornament Sequin Fabric Festive Home Decor Gift
-3%
$6.05-6.60
No MOQ
Christmas Tree Hanging Ornaments Pink Plastic Foam Glitter Gingerbread House Ice Cream Snowman Cartoon Festive Home Decor
Christmas Tree Hanging Ornaments Pink Plastic Foam Glitter Gingerbread House Ice Cream Snowman Cartoon Festive Home Decor
like
Find Similar
Pink Christmas ice cream cone ornament with blue sequins and snowman style accents - Ice Cream Style A
Pink ice cream cone Christmas tree ornament with colorful beads and snowman style - Ice Cream Style B
Gingerbread house Christmas ornament with colorful candy details and white hanging loop - Gingerbread House Style C
Pink heart window Christmas gingerbread house ornament with snow roof and sequins - Gingerbread House Style D
+2
Christmas Tree Hanging Ornaments Pink Plastic Foam Glitter Gingerbread House Ice Cream Snowman Cartoon Festive Home Decor
$3.98-5.71
No MOQ
Free Shipping
Christmas Snow Globe Music Box Ornament Santa Claus Snowman Bear Resin Glass Desktop Decoration Retro Holiday Home Decor Gift
Christmas Snow Globe Music Box Ornament Santa Claus Snowman Bear Resin Glass Desktop Decoration Retro Holiday Home Decor Gift
like
Find Similar
Close-up of a Christmas snow globe music box with Santa and reindeer on a wooden table - 10*10*14cm / Wreath Santa (With Music)
Vintage Christmas snow globe with white bear and golden countdown tree on wood table - 11*9*9cm / Gift Bear (No Music)
Vintage train musical snow globe with Santa Claus relief and sparkling sequins inside - 12.5*6.5*11cm / Santa Claus Train (No Music)
Close-up of a Christmas snowman snow globe music box featuring a golden tree and house - 10.5*10.5*14cm / Retro Snowman (With Music)
+2
Christmas Snow Globe Music Box Ornament Santa Claus Snowman Bear Resin Glass Desktop Decoration Retro Holiday Home Decor Gift
$10.95-20.17
Mix MOQ : 6
Christmas Snowman Ornaments Resin Figurine Gingerbread House LED Glowing Desktop Decoration Winter Holiday Gift Cartoon
Christmas Snowman Ornaments Resin Figurine Gingerbread House LED Glowing Desktop Decoration Winter Holiday Gift Cartoon
like
Find Similar
Christmas snowman resin figurine wearing a red and blue knitted scarf and black hat - Male Snowman (7204B-01)
Cute female snowman Christmas ornament with red hat, green scarf, and resin knit texture - Female Snowman (7204B-02)
Christmas snowman resin gingerbread house figurine with snowy trees and cozy holiday decor - Snowman Snow House (7142R-02)
Gingerbread house Christmas ornament with snow roof and festive gingerbread man design - Gingerbread Man Happy House (7142L-02)
+2
Christmas Snowman Ornaments Resin Figurine Gingerbread House LED Glowing Desktop Decoration Winter Holiday Gift Cartoon
-30%
$3.18-4.47
No MOQ
Nordic Christmas Gnomes Snowman Plush Ornaments Pink Gold Velvet Knitted Fabric Holiday Home Decor Hanging Pendant
Nordic Christmas Gnomes Snowman Plush Ornaments Pink Gold Velvet Knitted Fabric Holiday Home Decor Hanging Pendant
like
Find Similar
Nordic pink gnome plush with a long white beard and gold-threaded knit pointed hat - Gold Hat Small
Pink velvet Nordic gnome plush with long white beard and gold ribbon tie decoration - Pink Hat Small
Pink velvet Christmas gnome decoration with long white beard and golden knitted hat detail - Gold Hat Large
Pink velvet Nordic gnome plush ornament with white long beard and braided details - Pink Hat Large
+2
Nordic Christmas Gnomes Snowman Plush Ornaments Pink Gold Velvet Knitted Fabric Holiday Home Decor Hanging Pendant
$2.88-4.32
Mix MOQ : 10
Free Shipping
Christmas LED Lantern Night Light Retro Acrylic Glass Warm Light Home Decor European Style Santa Snowman Pattern
Christmas LED Lantern Night Light Retro Acrylic Glass Warm Light Home Decor European Style Santa Snowman Pattern
like
Find Similar
Bronze LED Christmas lantern with Santa Claus scene and warm glowing lights - Bronze Santa Claus
Vintage bronze Christmas lantern with LED snowman scene and festive bokeh background - Bronze Snowman
White Christmas LED lantern with Santa Claus illustration and warm yellow lighting - White Santa Claus
White Christmas lantern with snowman scene and warm LED light, portable round ornament - White Snowman
+2
Christmas LED Lantern Night Light Retro Acrylic Glass Warm Light Home Decor European Style Santa Snowman Pattern
$1.70-1.84
Mix MOQ : 2
Christmas Burlap Gift Bags Handheld Jute Candy Pouch Cartoon Santa Snowman Applique For Holiday Party Decoration
Christmas Burlap Gift Bags Handheld Jute Candy Pouch Cartoon Santa Snowman Applique For Holiday Party Decoration
like
Find Similar
6 options
Christmas Burlap Gift Bags Handheld Jute Candy Pouch Cartoon Santa Snowman Applique For Holiday Party Decoration
$1.38
Mix MOQ : 2
Christmas Gift Bags Non Woven Reusable Holiday Tote Bag With Handle Santa Snowman Reindeer Printed Party Favor Wrapping
Christmas Gift Bags Non Woven Reusable Holiday Tote Bag With Handle Santa Snowman Reindeer Printed Party Favor Wrapping
like
Find Similar
Red Christmas non-woven tote bag featuring festive elk and tree patterns for gift packaging - Red Classic Snowman Reindeer
Red Christmas non-woven gift bag with snowman and reindeer prints for holiday treats - Red Cartoon Santa
Christmas non-woven gift bag with blue handles and Santa Claus reindeer star print - Blue Night Sky Snow Christmas
Teal non-woven Christmas gift bag featuring snowman and Santa Claus festive illustrations - Cyan Fresh Holiday Snowman
+2
Christmas Gift Bags Non Woven Reusable Holiday Tote Bag With Handle Santa Snowman Reindeer Printed Party Favor Wrapping
$0.29
Mix MOQ : 12
 · 
19 views
Christmas Wine Bottle Cover Knitted Acrylic Festive Table Decor Reindeer Snowman Patterns Party Dining Atmosphere Pom Pom
Christmas Wine Bottle Cover Knitted Acrylic Festive Table Decor Reindeer Snowman Patterns Party Dining Atmosphere Pom Pom
like
Find Similar
Knitted Christmas wine bottle cover with snowman pattern and pompom drawstring detail - Snowman
Green and red knitted Christmas wine bottle cover with tree pattern and white pom poms - Christmas Tree
Knitted Christmas wine bottle cover with red reindeer and snowflake patterns and pom-poms - Elk Style
Christmas knitted wine bottle cover featuring Santa gnome design and red pom pom ties - Red and Grey Rudolf Style
+2
Christmas Wine Bottle Cover Knitted Acrylic Festive Table Decor Reindeer Snowman Patterns Party Dining Atmosphere Pom Pom
$1.73
Mix MOQ : 2
 · 
25 views
Christmas Wooden Hanging Ornaments 3D Layered Santa Snowman Reindeer Tags For Holiday Tree Decor Party Favors
Christmas Wooden Hanging Ornaments 3D Layered Santa Snowman Reindeer Tags For Holiday Tree Decor Party Favors
like
Find Similar
Wooden Christmas hanging tag with 3D Santa Claus figure and hoho engraving on white background - Santa Claus
Christmas wooden snowman hanging ornament with SNOW sign and rustic hemp rope hanger - Snowman
Christmas reindeer wooden hanging tag with red nose and bright text for tree decor - Elk Style
Wooden Nutcracker Christmas tag with merry text and twine for tree decoration - KING Style
+2
Christmas Wooden Hanging Ornaments 3D Layered Santa Snowman Reindeer Tags For Holiday Tree Decor Party Favors
$0.49
Mix MOQ : 2
 · 
181 sold recently
Christmas Tree Hanging Ornaments Felt Fabric Star Santa Snowman Reindeer Pattern Metal Bell Wooden Button Holiday Decoration
Christmas Tree Hanging Ornaments Felt Fabric Star Santa Snowman Reindeer Pattern Metal Bell Wooden Button Holiday Decoration
like
Find Similar
Brown felt reindeer star ornament with wooden button and golden bell for Christmas trees - Xmas Hanging Reindeer / 22cm*10cm
Detail of Christmas snowman ornament on a red star base with a gold bell and ribbon - Xmas Hanging Snowman / 22cm*10cm
Detail view of star-shaped Santa ornament with houndstooth hat and golden bell decoration - Xmas Hanging Santa Claus / 22cm*10cm
Red felt star Christmas ornament with grey knitted hat and two white buttons on a jute rope - Knit Hat Star / 13cm*10cm / Red
+2
Christmas Tree Hanging Ornaments Felt Fabric Star Santa Snowman Reindeer Pattern Metal Bell Wooden Button Holiday Decoration
$0.55-0.66
No MOQ
Free Shipping
Christmas Acetate Hair Claw Clips Snowflake Snowman Gingerbread Man Coffee Cup Rhinestone Holiday Hair Accessories Women Girls
Christmas Acetate Hair Claw Clips Snowflake Snowman Gingerbread Man Coffee Cup Rhinestone Holiday Hair Accessories Women Girls
like
Find Similar
Deep blue snowflake hair claw clip with white patterns and sparkling rhinestones - Blue Rhinestone Snowflake
Handheld snowflake claw clip with white rhinestones and pearlescent finish - White Rhinestone Snowflake
Acetate hair claw clip in white snowflake shape with sparkling rhinestones decoration - White Textured Snowflake
Christmas snowman tanghulu hair claw clip with snowflake patterns for winter hairstyles - Candied Haw Snowman
+3
Christmas Acetate Hair Claw Clips Snowflake Snowman Gingerbread Man Coffee Cup Rhinestone Holiday Hair Accessories Women Girls
$3.17-4.03
Mix MOQ : 6
Free Shipping
Christmas Garden Flag Double Sided Linen Winter Snowman Cardinal Decoration Outdoor Yard Vertical Holiday Festive
Christmas Garden Flag Double Sided Linen Winter Snowman Cardinal Decoration Outdoor Yard Vertical Holiday Festive
like
Find Similar
Welcome Christmas snowman garden flag in double-sided linen hanging on a black metal stand - 45x30cm
Christmas garden flag with snowman wreath and red bow on a lamp post winter decor - 45x30cm
Linen garden flag with deer and Hello Winter text on a black metal holder outdoors - 45x30cm
Detail of Christmas garden flag with nativity scene silhouette on linen fabric background - 45x30cm
+4
Christmas Garden Flag Double Sided Linen Winter Snowman Cardinal Decoration Outdoor Yard Vertical Holiday Festive
$1.30
No MOQ
Christmas Snowman Santa Plush Doll Knit Wood Fabric Soft Handmade Holiday Home Tree Decor Nordic Ethnic Style Ornaments
Christmas Snowman Santa Plush Doll Knit Wood Fabric Soft Handmade Holiday Home Tree Decor Nordic Ethnic Style Ornaments
like
Find Similar
Ethnic Christmas snowman family set with festive red hats and knit scarves in three sizes - Ethnic Style (Snowman Family of Three)
Three-piece red plush snowman family set with grey scarves for Christmas decoration - Nordic Style (Red Snowman Family of Three)
Three-piece red checkered Christmas Santa doll set with stars and white curly beards - Scottish Santa (Family of Three)
Large ethnic style Christmas snowman figure with colorful patterned hat, 40cm height - Ethnic Style Large Snowman
+23
Christmas Snowman Santa Plush Doll Knit Wood Fabric Soft Handmade Holiday Home Tree Decor Nordic Ethnic Style Ornaments
-5%
$1.92-342.22
No MOQ
Christmas Snowman Doll Figurines Skiing Swinging Blue Knitted Plush Desktop Ornaments For Holiday New Year Party Decor
Christmas Snowman Doll Figurines Skiing Swinging Blue Knitted Plush Desktop Ornaments For Holiday New Year Party Decor
like
Find Similar
Standing 33cm Christmas plush snowman doll in blue knitted sweater and earflap hat - 33CM / Swinging Snowman (Usher Hat)
Blue plaid snowman Christmas doll decoration with knitted hat and scarf, 33cm height - 33CM / Swinging Snowman (Double Hat)
Blue plaid fabric skiing snowman doll with 20cm height indicator for Christmas decor - 20cm / Snowman Ornament (Usher Hat)
Blue plaid Christmas snowman doll with knit hat and scarf, standing 20cm tall - 20cm / Snowman Ornament (Double Hat)
+2
Christmas Snowman Doll Figurines Skiing Swinging Blue Knitted Plush Desktop Ornaments For Holiday New Year Party Decor
-5%
$2.46-6.57
Mix MOQ : 2
Christmas Window Stickers Static PVC Clings Santa Claus Snowman Reindeer Snowflake Double Sided Decals Holiday Decor
Christmas Window Stickers Static PVC Clings Santa Claus Snowman Reindeer Snowflake Double Sided Decals Holiday Decor
like
Find Similar
Christmas Santa Claus and reindeer window stickers set with 51 double-sided static decals - 2 Sheets Set (51 Pcs) Santa & Elves / 25*35cm
Christmas window stickers set featuring Santa, Reindeer and Snowman 22 and 16 pieces - 2 Sheets Set (38 Pcs) Double Santa / 25*35cm
6-sheet set of double-sided Christmas window stickers with Santa, snowman and deer - 6 Sheets Set (182 Pcs) / 25*35cm
Christmas window stickers set with 110 double-sided Santa Claus and snowflake decals - 4 Sheets Set (110 Pcs) Santa & Snowflake / 25*35cm
+1
Christmas Window Stickers Static PVC Clings Santa Claus Snowman Reindeer Snowflake Double Sided Decals Holiday Decor
-5%
$0.69-1.78
No MOQ
 · 
26 views
Christmas Snowman Cushion Cover Soft Velvet Watercolor Pattern Holiday Decorative Pillowcase Home Decor
Christmas Snowman Cushion Cover Soft Velvet Watercolor Pattern Holiday Decorative Pillowcase Home Decor
like
Find Similar
Christmas snowman watercolor throw pillow cover for living room sofa decoration - 45*45cm Short Plush No Core / Watercolor Snowman Style 1
Macro detail of Christmas snowman pillowcase with pink watercolor printing and soft texture - 45*45cm Short Plush No Core / Watercolor Snowman Style 2
Christmas snowman pillow cover with watercolor floral pattern for festive home decor - 45*45cm Short Plush No Core / Watercolor Snowman Style 3
Christmas snowman cushion cover with watercolor art and red scarf for home sofa decor - 45*45cm Short Plush No Core / Watercolor Snowman Style 4
+11
Christmas Snowman Cushion Cover Soft Velvet Watercolor Pattern Holiday Decorative Pillowcase Home Decor
$1.59
Mix MOQ : 2
Christmas Series Alloy Rhinestone Enamel Brooch Santa Claus Christmas Tree Snowman Festive Pin Jewelry For Party Decoration
Christmas Series Alloy Rhinestone Enamel Brooch Santa Claus Christmas Tree Snowman Festive Pin Jewelry For Party Decoration
like
Find Similar
Golden Christmas tree brooch with colorful enamel and hanging gift charms on white background - Christmas Tree With Gift Box (YNCP7812)
Christmas ice skate brooch with white enamel and colorful rhinestones on gold metal - Ice Skate (YNCP7601)
Christmas snowman brooch in white glitter with red hat and golden arms details - Snowman with Hat (YNCP7205)
Christmas gift box pendant in red and green enamel with glitter finish on white background - Christmas Gift Box (SHYP028)
+6
Christmas Series Alloy Rhinestone Enamel Brooch Santa Claus Christmas Tree Snowman Festive Pin Jewelry For Party Decoration
-9%
$0.92-1.31
No MOQ
 · 
15 sold recently
Christmas Pillowcase Cushion Cover Peach Skin Polyester Decorative Festive Reindeer Snowman Print Home Sofa Party Decor
Christmas Pillowcase Cushion Cover Peach Skin Polyester Decorative Festive Reindeer Snowman Print Home Sofa Party Decor
like
Find Similar
Detailed close-up of a festive Christmas wreath and golden Merry Christmas print on pillowcase - Red Wreath Merry Christmas
Detailed close-up of a festive red Merry Christmas pillow cover with holiday patterns - Deep Red Holiday Elements
Close-up of red Christmas pillow cover with green wreath and festive gold text - Red Heart Wreath Merry Christmas
Detail of green and red Christmas pillowcase with Merry Christmas text and rhinestones - Deep Green Patchwork Gift
+16
Christmas Pillowcase Cushion Cover Peach Skin Polyester Decorative Festive Reindeer Snowman Print Home Sofa Party Decor
$1.27
Mix MOQ : 2
Christmas Window Static Stickers PVC Santa Snowman Reindeer Snowflake Gingerbread Man Decals Holiday Party Decoration Glass
Christmas Window Static Stickers PVC Santa Snowman Reindeer Snowflake Gingerbread Man Decals Holiday Party Decoration Glass
like
Find Similar
Merry Christmas gingerbread man window clings with Santa and snowflake motifs - 2-Pack Combination BQ426+462
Gingerbread man and snowman Christmas window decals with Merry Christmas text for shops - 3-Pack Combination BQ422+424+460
Christmas Gingerbread Man and Snowman static window clings on glass doors - 4-Pack Combination BQ369+370+427+428
Christmas window static clings featuring gingerbread man, snowman and elf festive stickers - 4-Pack Combination BQ371+374+375+430
+15
Christmas Window Static Stickers PVC Santa Snowman Reindeer Snowflake Gingerbread Man Decals Holiday Party Decoration Glass
$0.58-2.16
Mix MOQ : 2
Christmas Alloy Charms Bracelet Women Men Red Green Braided Gold Chain Santa Snowman Elk Snowflake Rhinestone Artificial Pearl
Christmas Alloy Charms Bracelet Women Men Red Green Braided Gold Chain Santa Snowman Elk Snowflake Rhinestone Artificial Pearl
like
Find Similar
Christmas charm bracelet with Santa Claus pendant, red beads and festive braided rope - Santa Claus Style (HLBX2025-老人)
Detail of Christmas bracelet featuring Santa Claus charm, red and green braided rope, and beads - Santa Head Style (HLBX2025-老人头)
Detailed shot of Christmas bracelet with red and green braided rope, pearls and bells - Bell Style (HLBX2025-铃铛)
Close-up of Christmas bracelet with white reindeer charm, red beads and gold chain detail - Elk Style (HLBX2025-鹿)
+4
Christmas Alloy Charms Bracelet Women Men Red Green Braided Gold Chain Santa Snowman Elk Snowflake Rhinestone Artificial Pearl
$0.79
No MOQ
 · 
72 sold recently
Christmas Throw Pillow Cover Linen Blend Winter Snowman Santa Print Square Decorative Cushion Case For Sofa Home Holiday Decor
Christmas Throw Pillow Cover Linen Blend Winter Snowman Santa Print Square Decorative Cushion Case For Sofa Home Holiday Decor
like
Find Similar
Christmas linen pillow cover with pug illustration and Winter Wooferland typography - 45x45cm / Winter Wooferland Pattern (1)
Detail of linen Christmas pillowcase with red sleigh print and Jingle All The Way text - 45x45cm / Santa Sleigh & Carriage Pattern (2)
Linen Christmas pillow case with green wreath and Merry Bright text on a sofa - 45x45cm / Merry & Bright Wreath Style (3)
Linen Christmas pillow cover with red and white Joy To The World festive print - 45x45cm / Joy to the World Color Block Style (4)
+14
Christmas Throw Pillow Cover Linen Blend Winter Snowman Santa Print Square Decorative Cushion Case For Sofa Home Holiday Decor
$1.24
No MOQ
Festive Christmas Cushion Case Peach Skin Velvet Decorative Pillow Cover Cartoon Snowman Santa Winter Holiday Decor
Festive Christmas Cushion Case Peach Skin Velvet Decorative Pillow Cover Cartoon Snowman Santa Winter Holiday Decor
like
Find Similar
Christmas peach skin pillowcase featuring cute dogs on a red sleigh in Winter Wooferland - Winter Dogs Sled (1)
Christmas Peach Skin Cushion Cover with Reindeer Carriage and Jingle All The Way Print - Vintage Carriage Snow Scene (2)
Square Christmas peach skin pillowcase with Merry & Bright wreath print on white background - Red Bow Christmas Wreath (3)
Christmas peach skin pillowcase with JOY TO the world text and festive tree pattern - Wood Grain Silhouette Christmas Tree (4)
+14
Festive Christmas Cushion Case Peach Skin Velvet Decorative Pillow Cover Cartoon Snowman Santa Winter Holiday Decor
-4%
$1.04
No MOQ
Christmas House Socks Acrylic Knit Thick Warm Fleece Lined Anti Slip Indoor Floor Socks Snowman Reindeer Pattern Winter
Christmas House Socks Acrylic Knit Thick Warm Fleece Lined Anti Slip Indoor Floor Socks Snowman Reindeer Pattern Winter
like
Find Similar
Winter plush Christmas socks featuring snowman pattern and cozy white fleece cuffs - 35-42 / Navy Snowman
Winter thermal floor socks with blue panda pattern and thick plush fleece lining - 35-42 / Duck Bear
Winter plush floor socks with cute panda pattern and thick white fleece lining - 35-42 / Plaid Panda
Winter sherpa-lined polar bear Christmas socks with plush fleece and festive knit pattern - 35-42 / OK Bear
+14
Christmas House Socks Acrylic Knit Thick Warm Fleece Lined Anti Slip Indoor Floor Socks Snowman Reindeer Pattern Winter
-23%
$2.19
No MOQ
Christmas Knit Winter Scarf Thick Warm Reindeer Snowman Snowflake Jacquard Soft Festive Holiday Gift For Women Men
Christmas Knit Winter Scarf Thick Warm Reindeer Snowman Snowflake Jacquard Soft Festive Holiday Gift For Women Men
like
Find Similar
Cozy red and white argyle knit scarf with snowman motif and warm ribbed edges - Red Argyle
Classic red plaid knit scarf with long tassels for winter warmth and festive style - Red Plaid
Chic beige Christmas snowman knitted scarf with green trees and red polka dots pattern - Christmas Snowman Beige
Red and white houndstooth knitted scarf featuring playful smiley face patterns - Red Double-sided Smiley
+14
Christmas Knit Winter Scarf Thick Warm Reindeer Snowman Snowflake Jacquard Soft Festive Holiday Gift For Women Men
-5%
$4.90
No MOQ
 · 
35 sold recently
Christmas Pillowcase Blue Soft Short Plush Watercolor Snowman Santa Reindeer Decorative Cushion Cover Home Sofa Decor
Christmas Pillowcase Blue Soft Short Plush Watercolor Snowman Santa Reindeer Decorative Cushion Cover Home Sofa Decor
like
Find Similar
Blue Christmas throw pillow cover featuring Santa Claus and snow-covered trees - Santa Claus and Tree (CDR350-1)
Blue Christmas throw pillow cover featuring a floral deer art print in pastel colors - Artistic Deer and Flowers (CDR350-2)
Close-up of winter snowman illustration on light blue and pink decorative pillowcase - Dreamy Snowman (CDR350-3)
Blue Christmas tree and gift boxes printed on a white square decorative pillowcase - Blue Christmas Tree (CDR350-4)
+14
Christmas Pillowcase Blue Soft Short Plush Watercolor Snowman Santa Reindeer Decorative Cushion Cover Home Sofa Decor
$1.30
Mix MOQ : 2
Christmas Stockings Plush Knit Fabric Hanging Gift Bags For Fireplace Xmas Party Decoration Santa Snowman Reindeer Style
Christmas Stockings Plush Knit Fabric Hanging Gift Bags For Fireplace Xmas Party Decoration Santa Snowman Reindeer Style
like
Find Similar
Large Christmas stocking gift bag with Santa Claus 3D design 20cm hanging decor - 20x14cm / Small Santa Stocking
Christmas snowman gift stocking with red plaid cuff and festive branch hanging scene - 20x14cm / Small Snowman Stocking
Christmas stocking gift bag with reindeer design and red satin ribbon for hanging - 20x14cm / Small Reindeer Stocking
Green Christmas stocking with Santa Claus motif and wood buttons hanging on a tree - 46x27cm / 3-Button Santa Stocking
+14
Christmas Stockings Plush Knit Fabric Hanging Gift Bags For Fireplace Xmas Party Decoration Santa Snowman Reindeer Style
-5%
$1.64-5.48
Mix MOQ : 2
Christmas Door Mat Non Slip TPR Backing Recyclon Fabric Entrance Rug Santa Reindeer Snowman Cartoon Festive Home Decor
Christmas Door Mat Non Slip TPR Backing Recyclon Fabric Entrance Rug Santa Reindeer Snowman Cartoon Festive Home Decor
like
Find Similar
Christmas entrance mat with reindeer and Merry Christmas text on a red background - 40x60cm / Style-Reindeer Snowflakes
Red Christmas Santa doormat with Merry Christmas text on wooden floor entrance - 40x60cm / Style-Santa Holding Board
Red Christmas snowman entrance mat with Merry Christmas text for home holiday decor - 40x60cm / Style-Antler Snowman
Red Christmas reindeer entrance mat with Merry Christmas text on wooden floor - 40x60cm / Style-Reindeer Xmas Tree
+14
Christmas Door Mat Non Slip TPR Backing Recyclon Fabric Entrance Rug Santa Reindeer Snowman Cartoon Festive Home Decor
$1.95-4.40
Mix MOQ : 10
Christmas Door Mat Reclon Brushed Fabric Non-Slip TPR Backing Cartoon Santa Snowman Machine Washable Home Entrance Rug
Christmas Door Mat Reclon Brushed Fabric Non-Slip TPR Backing Cartoon Santa Snowman Machine Washable Home Entrance Rug
like
Find Similar
Red Christmas door mat featuring a cartoon reindeer and Merry Christmas text - 40*60cm / Red Nose Reindeer
Red Christmas door mat with Merry Christmas text and festive cartoon characters - 40*60cm / Christmas Group
Red Christmas doormat featuring Santa Claus and reindeer on a textured fabric - 40*60cm / Santa Sleigh
Cartoon Santa Claus red rectangular Christmas doormat with Merry Christmas print and snowflakes - 40*60cm / Santa Gift
+14
Christmas Door Mat Reclon Brushed Fabric Non-Slip TPR Backing Cartoon Santa Snowman Machine Washable Home Entrance Rug
$3.09-6.87
Mix MOQ : 10
Christmas Cookie Molds PLA Plastic 3D Embossing Stamp Cartoon Santa Snowman Reindeer Tree Shapes DIY Baking Tool Festive
Christmas Cookie Molds PLA Plastic 3D Embossing Stamp Cartoon Santa Snowman Reindeer Tree Shapes DIY Baking Tool Festive
like
Find Similar
Christmas tree cookie cutter set with press-on stamp for festive baking, 3.6x4.2cm - Christmas Tree
Christmas stocking shaped cookie mold with stamper, 3.9x4.2cm white plastic cutter - Red and White Enamel Christmas Sock
Christmas hat cookie cutter mold set with 3D stamper for festive holiday baking projects - Christmas Hat
Christmas gift box shape cookie cutter set made of food-grade plastic 3.9x3.9cm - Christmas Gift Box
+14
Christmas Cookie Molds PLA Plastic 3D Embossing Stamp Cartoon Santa Snowman Reindeer Tree Shapes DIY Baking Tool Festive
-4%
$0.80
Mix MOQ : 2
Christmas Tree Ornaments Hanging Decorations Santa Snowman Pinecones Plastic Foam For Festive Holiday Home Party Decor
Christmas Tree Ornaments Hanging Decorations Santa Snowman Pinecones Plastic Foam For Festive Holiday Home Party Decor
like
Find Similar
Red Christmas ball set in matte and glitter finishes with Santa Claus ornaments - 6Pcs Santa Ornaments + 24Pcs Red Christmas Balls Set
Golden hollow Christmas tree topper star with sparkling glitter coating for tree decoration - 1Pc Medium Gold Glitter Christmas Tree Topper Star
Pack of 6 white fuzzy Christmas ball ornaments with colorful stars and silver strings - 6Pcs 3cm White Flocked Snowballs With Colored Stars
White star Christmas ornaments with colorful glitter and silver hanging strings - 6Pcs White Foam Star Ornaments With Colored Glitter
+14
Christmas Tree Ornaments Hanging Decorations Santa Snowman Pinecones Plastic Foam For Festive Holiday Home Party Decor
$0.16-1.50
Mix MOQ : 2
Christmas Hair Claw Clips Transparent Acrylic Santa Claus Reindeer Snowman Pattern Shark Clip For Women Girls Holiday
Christmas Hair Claw Clips Transparent Acrylic Santa Claus Reindeer Snowman Pattern Shark Clip For Women Girls Holiday
like
Find Similar
Transparent acrylic Christmas hair claw clip with Santa and snowflake prints - Santa Claus Print (8CM)
Transparent acrylic hair claw clip with festive reindeer and snowflake prints - Reindeer Print (8CM)
Acrylic Christmas hair claw clip with festive gingerbread and snowman print patterns - Gingerbread House Print (8CM)
Transparent acrylic Christmas hair claw with Santa Claus, gift boxes, and pine branch prints - Mini Santa Claus Print (8CM)
+14
Christmas Hair Claw Clips Transparent Acrylic Santa Claus Reindeer Snowman Pattern Shark Clip For Women Girls Holiday
$0.92-1.30
No MOQ
Handmade Christmas Wool Felt Desktop Ornaments With Wooden Base Xmas Tree Reindeer Snowman Santa Claus Festive Decoration
Handmade Christmas Wool Felt Desktop Ornaments With Wooden Base Xmas Tree Reindeer Snowman Santa Claus Festive Decoration
like
Find Similar
Wooden reindeer Christmas ornament with red wool felt saddle and red yarn scarf on a base - Small Reindeer Ornament 18.5cm
Charming wooden reindeer figurine with red wool felt shawl and scarf for Christmas desk decor - Large Reindeer Ornament 22cm
Christmas reindeer figurine with red wool yarn body and gold star on wooden base - Wool Wrapped Sheep Ornament 14cm Red
Artistic Santa felt ornament with wooden base for Christmas tabletop decoration - Wool Wrapped Santa Ornament 19cm
+18
Handmade Christmas Wool Felt Desktop Ornaments With Wooden Base Xmas Tree Reindeer Snowman Santa Claus Festive Decoration
$3.23-6.05
No MOQ
Christmas Headband Plush LED Light Up Santa Snowman Reindeer Bear Costume Hair Accessories Festive Party Decoration For Kids Adults
Christmas Headband Plush LED Light Up Santa Snowman Reindeer Bear Costume Hair Accessories Festive Party Decoration For Kids Adults
like
Find Similar
Christmas headband with spring-loaded Santa Claus ornaments in red green plaid fabric - Flannel Non-Glowing Santa Style
Christmas headband with snowman on springs and red plaid hat for festive party costumes - Flannel Non-Glowing Snowman Style
Christmas reindeer headband with red velvet band and plush brown elk with plaid scarves - Flannel Non-Glowing Reindeer Style
Christmas headband featuring plush teddy bears with red plaid hats and spring accents - Flannel Non-Glowing Bear Style
+12
Christmas Headband Plush LED Light Up Santa Snowman Reindeer Bear Costume Hair Accessories Festive Party Decoration For Kids Adults
$0.52-0.92
No MOQ
Christmas Wreath Earrings Alloy Tinsel Ribbon With Bow Bell Santa Snowman Holiday Party Jewelry For Women
Christmas Wreath Earrings Alloy Tinsel Ribbon With Bow Bell Santa Snowman Holiday Party Jewelry For Women
like
Find Similar
Close-up of festive green plush Christmas wreath earrings with Santa and tree charms - Green Wreath Santa & Tree
Festive Christmas wreath hoop earrings with red and green tinsel and gold hooks - Red & Green Tinsel Large Hoop
Close-up of red woven hoop earrings with green beads for Christmas accessory detail - Red Tinsel Hoop with Green Beads
Macro shot of red and green beaded hoop earrings with a green fuzzy ball and silver hook - Red & Green Beaded Hoop with Green Pom-pom
+12
Christmas Wreath Earrings Alloy Tinsel Ribbon With Bow Bell Santa Snowman Holiday Party Jewelry For Women
$0.52-1.86
No MOQ
Free Shipping
Christmas Drop Earrings Acrylic Snowman Christmas Tree Bell Gingerbread House Festive Holiday Jewelry For Women Girls
Christmas Drop Earrings Acrylic Snowman Christmas Tree Bell Gingerbread House Festive Holiday Jewelry For Women Girls
like
Find Similar
Gingerbread style Christmas tree earrings in brown acrylic with colorful dots - Christmas Tree A
Christmas tree earrings with glitter yellow hearts and green woven coil design - Christmas Tree B Heart
Christmas earrings with Santa Claus patterns on green acrylic and red square studs - Green Irregular Motif
Christmas earrings featuring red studs and brown star pendants with snowflake patterns - Snowflake
+12
Christmas Drop Earrings Acrylic Snowman Christmas Tree Bell Gingerbread House Festive Holiday Jewelry For Women Girls
$0.92-1.18
No MOQ
Free Shipping
Christmas Window Stickers Static Cling PVC Reindeer Santa Claus Snowman Shop Glass Festive Decoration Xmas Decals
Christmas Window Stickers Static Cling PVC Reindeer Santa Claus Snowman Shop Glass Festive Decoration Xmas Decals
like
Find Similar
Christmas window static stickers featuring Santa Claus and snowman for festive glass decor - Christmas Tree Snowman Reindeer Hanging Style (HL-SDJDT-17-033)
Christmas window static stickers with Santa, snowman, and reindeer in festive indoor scene - Santa Snowman Cat White Bear Style (HL-SDTZ20-082)
Christmas window sticker set size guide with Santa, reindeer and snowman decals - Santa Snowman Penguin Sleigh Style (HL-SDTZ18-040)
Christmas window stickers set with Santa Claus and gift box motifs, 40cm x 23cm size - Roping Santa Gift Fence Style (HL-SDTZ-084)
+12
Christmas Window Stickers Static Cling PVC Reindeer Santa Claus Snowman Shop Glass Festive Decoration Xmas Decals
$1.12
No MOQ
 · 
15 views
Hand Painted Christmas Glass Wine Goblet Holiday Party Drinkware Santa Claus Christmas Tree Snowman Pattern
Hand Painted Christmas Glass Wine Goblet Holiday Party Drinkware Santa Claus Christmas Tree Snowman Pattern
like
Find Similar
540ml Santa Claus and Christmas tree themed clear glass egg cup for holiday dining - 540ml / Santa Egg Cup
Stemless Christmas wine glass with hand-painted snowman and gift box design, 540ml - 540ml / Snowman Egg Cup
Hand-painted wine glass featuring festive holly berry patterns for Christmas decor - 450ml / Christmas Holly
Hand-painted Santa Claus wine glass with red stem and festive Christmas tree background - 500ml / Santa Claus
+4
Hand Painted Christmas Glass Wine Goblet Holiday Party Drinkware Santa Claus Christmas Tree Snowman Pattern
$3.72-5.73
Mix MOQ : 2
 · 
33 views
3D Pop Up Christmas Greeting Cards With Red Envelopes Cartoon Santa Snowman Reindeer For Holiday Festive Wishes Cardstock
3D Pop Up Christmas Greeting Cards With Red Envelopes Cartoon Santa Snowman Reindeer For Holiday Festive Wishes Cardstock
like
Find Similar
3D Pop-up Christmas card featuring a green reindeer design with a red envelope - Reindeer & Christmas Tree
Red 3D Christmas card with cartoon rabbit and snowman, including a matching envelope - Rabbit & Snowman
3D pop-up Christmas card with blue snowman design and red envelope for holiday wishes - Snowman & Snowflake
3D pop-up Christmas card with cartoon figures, red envelope on wooden background - Child & Gift
+1
3D Pop Up Christmas Greeting Cards With Red Envelopes Cartoon Santa Snowman Reindeer For Holiday Festive Wishes Cardstock
$0.24
Mix MOQ : 8
Christmas Car Air Vent Clip Freshener Silicone Santa Reindeer Snowman Tree Auto Interior Decoration Festive Holiday Accessory
Christmas Car Air Vent Clip Freshener Silicone Santa Reindeer Snowman Tree Auto Interior Decoration Festive Holiday Accessory
like
Find Similar
Close-up of a snowman car air vent aromatherapy clip made of white resin and blue hat - Large Snowman
Cartoon Christmas tree air vent clip showing soft silicone texture on a car dashboard - Large Christmas Tree
Detailed view of a Santa Claus car air vent clip accessory on a black interior vent - Large Santa Claus
Close-up of a brown silicone reindeer car vent clip with a red Christmas hat and scarf - Large Reindeer
+1
Christmas Car Air Vent Clip Freshener Silicone Santa Reindeer Snowman Tree Auto Interior Decoration Festive Holiday Accessory
$1.04
Mix MOQ : 2
 · 
23 sold recently
Christmas Burlap Ribbon With Printed Snowman Red Car Xmas Tree Pattern Wired Edge Ribbon For Holiday Gift Wrapping Tree Decoration
Christmas Burlap Ribbon With Printed Snowman Red Car Xmas Tree Pattern Wired Edge Ribbon For Holiday Gift Wrapping Tree Decoration
like
Find Similar
6m Christmas ribbon with snowman print on burlap texture for tree decoration - Snowman (5500309749705) / 2m
Red Christmas ribbon with vintage truck and tree print for festive tree decoration - Red Car (5500309749706) / 2m
5cm Christmas ribbon with vintage red truck and tree print on cream linen fabric - Cream Car (5500309749707) / 2m
6m Christmas car and tree print ribbon for festive party tree decorations - Gray Car (5500309749708) / 2m
+21
Christmas Burlap Ribbon With Printed Snowman Red Car Xmas Tree Pattern Wired Edge Ribbon For Holiday Gift Wrapping Tree Decoration
-5%
$0.82-3.29
No MOQ
Christmas Lantern LED Night Light Plastic Retro Hanging Candle Lamp Party Decor Santa Snowman Reindeer Ornament
Christmas Lantern LED Night Light Plastic Retro Hanging Candle Lamp Party Decor Santa Snowman Reindeer Ornament
like
Find Similar
Close-up of red Christmas lantern with Santa Claus pattern and warm LED candlelight - Red Santa Claus
Close-up of white Christmas LED lantern with snowman print on a festive wooden surface - White Snowman
White Christmas lantern with forest and deer design on a warm wood tabletop with soft bokeh - White Reindeer
Detail of vintage bronze Christmas lantern with snowman patterns and warm LED candle light - Brushed Gold Snowman
+2
Christmas Lantern LED Night Light Plastic Retro Hanging Candle Lamp Party Decor Santa Snowman Reindeer Ornament
-4%
$0.96
No MOQ
Christmas Hat Chair Covers And Tablecloth Non Woven Fabric Red And White Dining Room Holiday Party Decoration Santa Clause Snowman Patterns
Christmas Hat Chair Covers And Tablecloth Non Woven Fabric Red And White Dining Room Holiday Party Decoration Santa Clause Snowman Patterns
like
Find Similar
Red and white double-layered Christmas tablecloth for festive home dining table decor - Non-woven Christmas Tablecloth
Christmas Santa Claus and snowman chair back covers for festive dining room decoration - Red Border Printed Chair Cover
Red Santa hat chair cover with white pompom for festive Christmas dining decor - Non-woven Fabric Chair Cover
12-piece Christmas dining set with 6 red hat chair covers and 6 matching cutlery holders - 6 Chair Covers + 6 Cutlery Holders
+7
Christmas Hat Chair Covers And Tablecloth Non Woven Fabric Red And White Dining Room Holiday Party Decoration Santa Clause Snowman Patterns
$0.47-4.90
No MOQ
Christmas Hair Clips Knitted Yarn Santa Snowman Reindeer Tree Bell Socks BB Hairpins Handmade Winter Holiday Accessory
Christmas Hair Clips Knitted Yarn Santa Snowman Reindeer Tree Bell Socks BB Hairpins Handmade Winter Holiday Accessory
like
Find Similar
Close-up of handmade knitted Christmas snowman hair clip with red and green embroidery - Knitted Snowman
Detailed close-up of handmade red knit Christmas sock hair clip with snowflake embroidery - Knitted Christmas Stocking
Detail of hand-knitted green Christmas tree hair clip with red star and ornaments - Knitted Christmas Tree
Detail of a handmade knitted Christmas reindeer hair clip with a red nose and bell - Knitted Reindeer
+3
Christmas Hair Clips Knitted Yarn Santa Snowman Reindeer Tree Bell Socks BB Hairpins Handmade Winter Holiday Accessory
$0.20
No MOQ
 · 
16 views
Miniature Christmas Tree And Snowman Figurine Transparent Resin Desktop Micro Landscape Decor Festival DIY Ornaments
Miniature Christmas Tree And Snowman Figurine Transparent Resin Desktop Micro Landscape Decor Festival DIY Ornaments
like
Find Similar
Miniature purple and blue gradient resin Christmas tree with size details for DIY decor - 1# Blue Purple Christmas Tree
Miniature gradient glass Christmas tree ornament with colorful beads, 3.7cm height - 2# Green Yellow Christmas Tree
Miniature blue gradient glass Christmas tree ornament with yellow star 3.5cm height - 3# Blue Christmas Tree
Miniature 3.5cm transparent green Christmas tree DIY decor with yellow star and snow base - 4# Green Christmas Tree
+3
Miniature Christmas Tree And Snowman Figurine Transparent Resin Desktop Micro Landscape Decor Festival DIY Ornaments
$0.17-0.26
Mix MOQ : 3
Christmas Socks Coral Fleece Thick Warm Winter Home Floor Hosiery Santa Reindeer Snowman Cartoon Patterns For Women
Christmas Socks Coral Fleece Thick Warm Winter Home Floor Hosiery Santa Reindeer Snowman Cartoon Patterns For Women
like
Find Similar
Close-up of fluffy Christmas coral fleece socks with ginger man embroidery and gift box - One Size / Red Green Striped Bear Stars
Soft coral fleece Christmas sock with Santa pattern on white plush carpet background - One Size / Red Hat Santa Claus
Close-up of red and white fuzzy Christmas socks with a Santa Claus pattern and plush texture - One Size / Green Hat Santa Claus
Detail of green Christmas sock with festive patterns on white fur with holiday ornaments - One Size / Green Christmas Gift
+3
Christmas Socks Coral Fleece Thick Warm Winter Home Floor Hosiery Santa Reindeer Snowman Cartoon Patterns For Women
$0.84
Mix MOQ : 2
Christmas Earrings Alloy Enamel Santa Claus Snowman Christmas Tree With Silver Earring Post Festive Holiday Jewelry Women
Christmas Earrings Alloy Enamel Santa Claus Snowman Christmas Tree With Silver Earring Post Festive Holiday Jewelry Women
like
Find Similar
Asymmetric Christmas earrings featuring red bows with snowman and snowflake charms - E4501 Snowflake Snowman
Christmas tree earrings with red star and white tree design for holiday festive style - E2329 Christmas Tree
Asymmetric Christmas earrings featuring Santa Claus and red elk ball with bows - E2477 Santa Claus Elk
Festive Christmas hat earrings with red bells and green wreaths on white background - E2478 Bell Wreath
+3
Christmas Earrings Alloy Enamel Santa Claus Snowman Christmas Tree With Silver Earring Post Festive Holiday Jewelry Women
-5%
$0.87
No MOQ
Free Shipping
Christmas Tree Ornaments Hanging Plush Dolls Santa Snowman Reindeer Bear Candy Cane Fabric Festive Holiday Decoration
Christmas Tree Ornaments Hanging Plush Dolls Santa Snowman Reindeer Bear Candy Cane Fabric Festive Holiday Decoration
like
Find Similar
Plush snowman hanging ornament with red plaid hat and gold candy cane decoration - Snowman With Candy Cane
Plush Christmas snowman ornament with red checkered hat and scarf on white rope - Snowman Climbing Rope
Christmas reindeer plush ornament with red plaid vest holding candy cane for tree decor - Reindeer With Candy Cane
Classic Santa Claus plush ornament with red checkered details for Christmas tree hanging - Santa Claus Climbing Rope
+3
Christmas Tree Ornaments Hanging Plush Dolls Santa Snowman Reindeer Bear Candy Cane Fabric Festive Holiday Decoration
$0.72
Mix MOQ : 2
 · 
17 views
Free Shipping
Christmas Tabletop Ornaments Wooden Gingerbread Man Santa Claus Snowman Gnome Festive Desktop Decoration Cartoon Style
Christmas Tabletop Ornaments Wooden Gingerbread Man Santa Claus Snowman Gnome Festive Desktop Decoration Cartoon Style
like
Find Similar
Gingerbread man wooden table decor with blue apron and hat for Christmas ornament - Gingerbread Man with Candy Cane
Wooden gingerbread man decor with chef hat and polka dot apron for Christmas table - Candy Gingerbread Man
Wooden Santa Claus tabletop ornament with gift box and base for Christmas decor - Santa Claus
Cartoon wooden snowman desk ornament with JOY text and candy cane Christmas decor - Snowman
+3
Christmas Tabletop Ornaments Wooden Gingerbread Man Santa Claus Snowman Gnome Festive Desktop Decoration Cartoon Style
$0.81
Mix MOQ : 2
 · 
32 views
Christmas Hair Claw Clips Acrylic Santa Claus Snowman Tree Hat Hairpins Festive Hair Accessories For Women
Christmas Hair Claw Clips Acrylic Santa Claus Snowman Tree Hat Hairpins Festive Hair Accessories For Women
like
Find Similar
Detail of green Christmas tree hair claw clip with colorful dots on a festive knit background - Christmas Tree Claw Clip-7cm
Cute Santa Claus hair claw clip in red and white with stars for Christmas styling - Cute Santa Claus Claw Clip-6.7cm
Detailed close-up of a white snowman Christmas hair claw with red hat and green scarf - Snowman Claw Clip-7.2cm
Macro view of Santa Claus hair claw clip showing glossy acrylic details and red accents - Santa Claus Claw Clip-7cm
+3
Christmas Hair Claw Clips Acrylic Santa Claus Snowman Tree Hat Hairpins Festive Hair Accessories For Women
$1.44
No MOQ
 · 
46 sold recently
Christmas Garden Flag With Metal Stand Watercolor Snowman Winter Outdoor Decorative Polyester Double Sided Yard Decor
Christmas Garden Flag With Metal Stand Watercolor Snowman Winter Outdoor Decorative Polyester Double Sided Yard Decor
like
Find Similar
Winter snowman garden flag with linen texture and metal stand for Christmas outdoor decor - Snowman with Orange Hat (HYQ43-1)
Winter snowman garden flag in soft watercolor style on textured linen fabric - Snowman with Pink Striped Hat (HYQ43-2)
Winter snowman garden flag decoration with pink floral patterns and a black metal stand - Snowman with Pink Hat and Flowers (HYQ43-3)
Winter snowman garden flag decoration with watercolor design and black metal hanger - Snowman with Red Striped Hat and Berries (HYQ43-4)
+8
Christmas Garden Flag With Metal Stand Watercolor Snowman Winter Outdoor Decorative Polyester Double Sided Yard Decor
$1.59
Mix MOQ : 2
Linen Christmas Pillow Case Pink Vintage Santa Claus Snowman Digital Print Throw Cushion Cover For Sofa Home Living Room
Linen Christmas Pillow Case Pink Vintage Santa Claus Snowman Digital Print Throw Cushion Cover For Sofa Home Living Room
like
Find Similar
Pink linen Christmas pillow case with hello WINTER text and festive ornaments print - Hello Winter (YMD381-1) / 45x45cm
Pink linen Christmas pillow case with white geometric tree and Sweet Christmas text design - Sweet Christmas (YMD381-2) / 45x45cm
Pink striped Christmas pillow cover featuring a vintage Santa Claus print for home decor - Santa Claus (YMD381-3) / 45x45cm
Pink striped Christmas snowman pillow cover with blue birds and linen texture - Snowman (YMD381-4) / 45x45cm
+4
Linen Christmas Pillow Case Pink Vintage Santa Claus Snowman Digital Print Throw Cushion Cover For Sofa Home Living Room
$1.30-1.38
Mix MOQ : 2
LED Light Up Christmas Gnome Ornaments Glowing Plush Scandinavian Tomte Santa Snowman Figures Holiday Home Decor
LED Light Up Christmas Gnome Ornaments Glowing Plush Scandinavian Tomte Santa Snowman Figures Holiday Home Decor
like
Find Similar
White glowing Christmas gnome plush with knit star hat and long faux fur beard - WZ20002 White Old Man Head
Pink striped knit Christmas gnome ornament with glowing body and silver star details - WZ20002 Pink Old Man Head
Red Christmas gnome ornament with glowing warm LED light and gold glitter stars - WZ20002 Red Old Man Head
Pink Christmas gnome with white hat and glowing nose on wooden skis for holiday decor - WZ20006 White Skiing Snowman
+2
LED Light Up Christmas Gnome Ornaments Glowing Plush Scandinavian Tomte Santa Snowman Figures Holiday Home Decor
-5%
$3.50-5.15
No MOQ
Free Shipping
Christmas Charm Bracelet Alloy Glass Beads Snake Chain Festive Holiday Jewelry Enamel Snowman Snowflake Gift
Christmas Charm Bracelet Alloy Glass Beads Snake Chain Festive Holiday Jewelry Enamel Snowman Snowflake Gift
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - Silver Basic Chain (18cm)
Christmas charm bracelet with red and green glass beads and silver festive pendants - SD-0008 Christmas Full Set
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - Silver Snake Chain (18+5cm Extension)
+3
Christmas Charm Bracelet Alloy Glass Beads Snake Chain Festive Holiday Jewelry Enamel Snowman Snowflake Gift
$0.73-4.06
No MOQ
Free Shipping
Christmas Stud Earrings Alloy Oil Drop Santa Snowman Reindeer Snowflake Novelty Holiday Festive Jewelry Women
Christmas Stud Earrings Alloy Oil Drop Santa Snowman Reindeer Snowflake Novelty Holiday Festive Jewelry Women
like
Find Similar
6-pair set of Christmas earrings featuring reindeer, snowflakes, and festive trees - Christmas Tree and Bell Style (6686)
6-pack Christmas themed earring set with Santa, tree and gift box on jewelry card - Santa and Snow House Style (6843)
6-pair Christmas stud earrings set featuring festive elk, snowman and pearl designs - Angel and Reindeer Style (G-411)
6-pair Christmas stud earrings set featuring reindeer, Santa, and tree on a card - Reindeer and Angel Combo Style (7375)
+2
Christmas Stud Earrings Alloy Oil Drop Santa Snowman Reindeer Snowflake Novelty Holiday Festive Jewelry Women
-5%
$1.07
No MOQ
 · 
57 sold recently
Christmas Gift Boxes House Shape Cardboard Handheld Folding Candy Treat Box Holiday Party Snowman Gingerbread Pattern
Christmas Gift Boxes House Shape Cardboard Handheld Folding Candy Treat Box Holiday Party Snowman Gingerbread Pattern
like
Find Similar
Pink Christmas gift box with handle featuring cute snowman and tree graphics - Pink Christmas Snowman Style / 11*7*7cm
Gingerbread house style Christmas gift box with handle and festive candy cane prints - Kraft Gingerbread House Style / 11*7*7cm
Christmas Gift Boxes House Shape Cardboard Handheld Folding Candy Treat Box Holiday Party Snowman Gingerbread Pattern
$0.23
No MOQ
 · 
30 sold recently
Cartoon Christmas Keychain Metal Reindeer Snowman Santa Claus Bag Pendant Alloy Artificial Pearl Rhinestone Christmas Gift
Cartoon Christmas Keychain Metal Reindeer Snowman Santa Claus Bag Pendant Alloy Artificial Pearl Rhinestone Christmas Gift
like
Find Similar
Detail of Christmas tree keychain with gold clip and white pearl on festive background - Christmas Tree
Detailed view of Christmas reindeer keychain with enamel finish and pearl charm detail - Elk
Detailed view of Christmas moon keychain with golden lobster clasp and faux pearl accessory - Moon with Christmas Hat
Christmas Santa Claus keychain with lobster clasp and white pearl charm on festive background - Bubble Blowing Santa
+11
Cartoon Christmas Keychain Metal Reindeer Snowman Santa Claus Bag Pendant Alloy Artificial Pearl Rhinestone Christmas Gift
-9%
$0.60
Mix MOQ : 2
Free Shipping
Christmas Laser Cut Cupcake Wrappers Hollow Out Snowman Tree Cake Decoration For Wedding Birthday Party Holiday Supplies
Christmas Laser Cut Cupcake Wrappers Hollow Out Snowman Tree Cake Decoration For Wedding Birthday Party Holiday Supplies
like
Find Similar
Macro shot of white laser-cut Christmas tree cupcake liners with festive snowman hollow patterns - 5cm / White
Pink Christmas laser cut paper cupcake wrappers with festive snowflake and tree patterns - 5cm / Pink
Golden laser-cut Christmas cupcake wrappers with festive reindeer and snowflake patterns - 5cm / Gold
Detail of red laser-cut cupcake wrapper with Merry Christmas text and holiday motifs - 5cm / Pearlescent Red
+11
Christmas Laser Cut Cupcake Wrappers Hollow Out Snowman Tree Cake Decoration For Wedding Birthday Party Holiday Supplies
$0.09
Mix MOQ : 50
Moving Ears Christmas Hat Santa Claus Reindeer Snowman Plush Festive Party Hat For Women Kids Winter Warm Novelty Headwear Gift
Moving Ears Christmas Hat Santa Claus Reindeer Snowman Plush Festive Party Hat For Women Kids Winter Warm Novelty Headwear Gift
like
Find Similar
Christmas Santa plush hat with moving ears and long scarves in red and white - L (Independent Packaging) / Santa Claus Hat Pattern
Brown plush reindeer hat with moving ears and antlers for Christmas party decoration - L (Independent Packaging) / Reindeer Hat
White plush snowman hat with moving ears and red accents for kids and adults - L (Independent Packaging) / Snowman Hat Style
Plush red Santa hat with silver snowflakes and cute moving ear flaps for Christmas - L (Independent Packaging) / Snowflake Santa
+6
Moving Ears Christmas Hat Santa Claus Reindeer Snowman Plush Festive Party Hat For Women Kids Winter Warm Novelty Headwear Gift
-5%
$4.80-5.48
Mix MOQ : 2
Christmas Gift Boxes Cardboard Paper Folding 3D Pop Up Cartoon Santa Snowman Reindeer Treat Candy Cookie Wrapping
Christmas Gift Boxes Cardboard Paper Folding 3D Pop Up Cartoon Santa Snowman Reindeer Treat Candy Cookie Wrapping
like
Find Similar
White Christmas gift box with 3D polar bear, Santa and reindeer cardboard characters - 15x9x4cm (10 Pcs/Pack) / White
Green Christmas gift box with 3D cartoon characters and festive holiday illustrations - 15x9x4cm (10 Pcs/Pack) / Green
Christmas Santa Claus gift box made of brown kraft paper for sweets and treats - 15x9x4cm (10 Pcs/Pack) / Kraft Paper Color
Christmas Gift Boxes Cardboard Paper Folding 3D Pop Up Cartoon Santa Snowman Reindeer Treat Candy Cookie Wrapping
-11%
$1.55
No MOQ
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access