Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Charm Bracelet Alloy Enamel Glass Beads Snowman Candy Cane Bell Pendants Festive Snake Chain Jewelry Gift
Christmas Charm Bracelet Alloy Enamel Glass Beads Snowman Candy Cane Bell Pendants Festive Snake Chain Jewelry Gift
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - Barrel Clasp Snake Chain / 18cm
Christmas charm bracelet with snowman, candy cane pendants and red crystal beads - Christmas Theme Bead Set
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - Lobster Clasp Snake Chain with Extension / 18+5cm
+3
Christmas Charm Bracelet Alloy Enamel Glass Beads Snowman Candy Cane Bell Pendants Festive Snake Chain Jewelry Gift
$0.73-3.88
No MOQ
 · 
12 views
Free Shipping
Christmas Gift Wrapping Paper Roll Pink Aesthetic Cartoon Santa Snowman Coated Paper For Holiday Presents Decor
Christmas Gift Wrapping Paper Roll Pink Aesthetic Cartoon Santa Snowman Coated Paper For Holiday Presents Decor
like
Find Similar
Pink Christmas wrapping paper roll featuring Santa, snowman, and reindeer illustrations - 43cm Wide X 3m Long / Calf Gift Pattern
Vibrant candy pink kraft gift wrapping paper roll with a smooth matte texture finish - 43cm Wide X 3m Long / Pink
Pink Christmas wrapping paper roll featuring watercolor tree patterns for festive gift decor - 43cm Wide X 3m Long / Pink Pine Tree
Pink Christmas wrapping paper rolls featuring Santa, reindeer and tree patterns, 43cmx3m - 43cm Wide X 3m Long / Set 1
+1
Christmas Gift Wrapping Paper Roll Pink Aesthetic Cartoon Santa Snowman Coated Paper For Holiday Presents Decor
-5%
$1.09-3.45
No MOQ
 · 
23 views
Vintage Christmas Tablecloth Rectangular Polyester Red Plaid Snowman Bell Bear Print Holiday Dining Table Cover Decoration
Vintage Christmas Tablecloth Rectangular Polyester Red Plaid Snowman Bell Bear Print Holiday Dining Table Cover Decoration
like
Find Similar
Red Christmas tablecloth with snowman and snowflake prints featuring white wavy edges - 140*100cm / Snowman
Christmas tablecloth with festive prints and scalloped edges for holiday table decoration - 140*100cm / Christmas Bell
Red plaid Christmas tablecloth with festive ornaments and pine needles for dining decor - 140*100cm / Christmas Plaid
Christmas tablecloth with teddy bears and poinsettia pattern in festive home setting - 140*100cm / Christmas Gift Bear
+20
Vintage Christmas Tablecloth Rectangular Polyester Red Plaid Snowman Bell Bear Print Holiday Dining Table Cover Decoration
-4%
$4.08-8.74
No MOQ
3D Pop Up Christmas Greeting Card Cardstock Santa Reindeer Snowman Handwritten Blessing Card Envelope Festive
3D Pop Up Christmas Greeting Card Cardstock Santa Reindeer Snowman Handwritten Blessing Card Envelope Festive
like
Find Similar
3D pop-up Christmas card with gingerbread house and rabbit design, size 11x11cm - Winter Partners (No Envelope)
3D Pop-up Christmas card with snowman design and red envelope for holiday greetings - Magic Snowman (With Envelope)
3D Pop-up Christmas card with Santa Claus and red envelope in festive setting - Bell Santa (With Envelope)
3D Christmas card with reindeer design and red envelope set for holiday greetings - Crystal Ball Deer (With Envelope)
+3
3D Pop Up Christmas Greeting Card Cardstock Santa Reindeer Snowman Handwritten Blessing Card Envelope Festive
$0.20
Mix MOQ : 2
Vintage Christmas Resin Ornaments Santa Claus Snowman Miniature Desktop Decor Festive Wood Grain Texture Home Decoration
Vintage Christmas Resin Ornaments Santa Claus Snowman Miniature Desktop Decor Festive Wood Grain Texture Home Decoration
like
Find Similar
Resin Santa Claus ornament with gift and wreath, holiday tabletop decor, 12x9cm size - Santa Claus Carrying Wreath Style (18062)
Vintage resin snowman figurine with red polka dot scarf for Christmas desktop decor - Retro Polka Dot Scarf Snowman Style (1号)
Resin snowman figurine with tartan scarf and black hat, winter decor, 10x10cm size - Plaid Scarf Round Snowman Style (18062 Snowman)
Resin Santa Claus figurine with brown gift bag, festive 14x10cm holiday desk decoration - Large Santa Claus with Gift Bag Figurine
+3
Vintage Christmas Resin Ornaments Santa Claus Snowman Miniature Desktop Decor Festive Wood Grain Texture Home Decoration
-4%
$1.78-4.33
No MOQ
Christmas Earrings Polymer Clay Handmade Snowman Santa Claus Christmas Tree Festive Holiday Jewelry For Women Girls
Christmas Earrings Polymer Clay Handmade Snowman Santa Claus Christmas Tree Festive Holiday Jewelry For Women Girls
like
Find Similar
Detail of Christmas snowman drop earrings with red scarves and festive resin texture - Style 1-Snowman with Red Scarf
Detailed close-up of festive red white and green striped candy cane Christmas earrings - Style 2-Tri-color Candy Cane
Detailed macro shot of green star-shaped clay earrings with festive colorful dots pattern - Style 6-Colorful Dotted Star
Christmas Santa Claus earrings with red triangle base and green holly leaves design - Style 3-Santa Claus
+3
Christmas Earrings Polymer Clay Handmade Snowman Santa Claus Christmas Tree Festive Holiday Jewelry For Women Girls
$0.39-1.81
No MOQ
 · 
15 views
Free Shipping
Christmas Nail Art Charms 3D Resin Decorations Santa Claus Reindeer Snowman Tree Star Gloves For DIY Manicure Crafts
Christmas Nail Art Charms 3D Resin Decorations Santa Claus Reindeer Snowman Tree Star Gloves For DIY Manicure Crafts
like
Find Similar
Cute resin snowman nail art charm with red hat for DIY manicures and holiday crafts - #3 Christmas Snowman
Set of 7 resin Santa Claus nail charms in red and white for festive DIY manicures - #1 Santa Claus
Cute green resin Christmas tree charms for DIY nail art and festive accessories - #4 Christmas Tree
3D resin Christmas nail charms featuring red glove and white snowflake patterns - #6 Christmas Glove
+3
Christmas Nail Art Charms 3D Resin Decorations Santa Claus Reindeer Snowman Tree Star Gloves For DIY Manicure Crafts
$0.03
Mix MOQ : 20
 · 
14 views
Wool Felt Christmas Ornaments Gnomes Santa Snowman Angel Plush Dolls For Xmas Tree Hanging Decoration Festive Home Decor
Wool Felt Christmas Ornaments Gnomes Santa Snowman Angel Plush Dolls For Xmas Tree Hanging Decoration Festive Home Decor
like
Find Similar
Set of 4 plush Christmas gnome ornaments in white and burgundy with sequins - Long Bearded Old Man (APYX156)
Set of 4 Christmas gnome ornaments with knitted hats and long beards in gift box - Bearded Mini Doll (APYX155-4)
Three Christmas gnome wool felt ornaments in red white and khaki colors inside a gift box - Hatted Doll (APYX156)
Set of two plush Christmas gnomes with red striped hats and white beards in a gift box - Cleaner Style (APYX155-4)
+7
NewWool Felt Christmas Ornaments Gnomes Santa Snowman Angel Plush Dolls For Xmas Tree Hanging Decoration Festive Home Decor
-4%
$3.81-6.28
No MOQ
Free Shipping
Christmas Earrings Acrylic Santa Claus Snowman Gingerbread House Xmas Tree Festive Cartoon Jewelry For Women Girls
Christmas Earrings Acrylic Santa Claus Snowman Gingerbread House Xmas Tree Festive Cartoon Jewelry For Women Girls
like
Find Similar
Close-up of Santa Claus in wreath acrylic Christmas earrings on blue background - Santa Claus Wreath
Detailed close-up of festive gingerbread house earrings on dark blue textured fabric - Candy House
Close-up of red Christmas ball earrings with white snowflake patterns on blue fabric - Christmas Ball
Close-up of cute snowman acrylic earrings featuring black hats and red scarves - Snowman
+2
Christmas Earrings Acrylic Santa Claus Snowman Gingerbread House Xmas Tree Festive Cartoon Jewelry For Women Girls
$0.39
Mix MOQ : 2
 · 
14 sold recently
Free Shipping
Christmas Sleigh Ornaments Wooden DIY Assembly Tabletop Decoration Santa Snowman Reindeer Festive Xmas Desktop Scene Decor
Christmas Sleigh Ornaments Wooden DIY Assembly Tabletop Decoration Santa Snowman Reindeer Festive Xmas Desktop Scene Decor
like
Find Similar
Small size Santa Claus themed painted wooden Christmas sled decoration with Xmas letters - Small Santa
DIY wooden Christmas sleigh ornament with green tree and small snowman figures - Small Snowman
DIY painted wooden Christmas sleigh ornament with small reindeer and green tree - Small Size Reindeer
Large size painted wooden Christmas sleigh puzzle with Santa Claus and XMAS letters - Large Santa
+2
Christmas Sleigh Ornaments Wooden DIY Assembly Tabletop Decoration Santa Snowman Reindeer Festive Xmas Desktop Scene Decor
-4%
$1.10-1.92
No MOQ
 · 
10 views
Christmas Candy Basket Bamboo Woven Storage Decor Santa Snowman Reindeer Penguin Gingerbread Man Plush Desktop Ornament
Christmas Candy Basket Bamboo Woven Storage Decor Santa Snowman Reindeer Penguin Gingerbread Man Plush Desktop Ornament
like
Find Similar
Gingerbread man themed Christmas candy basket with festive knit scarf and brown wicker - Small Gingerbread Man
Christmas snowman woven candy basket for desktop holiday decoration and gifts - Small Snowman
Christmas Santa Claus plush doll with small woven wicker candy basket for holiday decor - Small Santa Claus
Christmas Santa Claus mini woven candy basket for desktop decoration and festive gifts - Large Santa Claus
+2
Christmas Candy Basket Bamboo Woven Storage Decor Santa Snowman Reindeer Penguin Gingerbread Man Plush Desktop Ornament
-5%
$2.60-3.43
No MOQ
Dog Rope Toy Christmas Holiday Cotton Plush Teething Cleaning Festive Santa Snowman Tree For Pets
Dog Rope Toy Christmas Holiday Cotton Plush Teething Cleaning Festive Santa Snowman Tree For Pets
like
Find Similar
Christmas tree plush dog chew toy with colorful embroidery and red white green rope knot - Christmas Tree
Christmas dog plush ring toy with green holly wreath and braided colorful rope - Christmas Wreath
Detail of Christmas dog chew toy with plush gift bag head and colorful woven cotton rope knot - Christmas Gift Bag
Detailed view of snowman plush dog toy with durable braided cotton rope for chewing - Snowman
+2
Dog Rope Toy Christmas Holiday Cotton Plush Teething Cleaning Festive Santa Snowman Tree For Pets
-4%
$1.07
No MOQ
 · 
19 views
Christmas Hair Ties Elastic Ponytail Holders With Plastic Resin Santa Claus Snowman Reindeer Tree Charms Holiday Accessory
Christmas Hair Ties Elastic Ponytail Holders With Plastic Resin Santa Claus Snowman Reindeer Tree Charms Holiday Accessory
like
Find Similar
Close-up of Christmas hair tie with red and green cords and a snowflake bell charm - Christmas Bell
Detail of Christmas reindeer hair tie with red and green elastic bands and 3D charm - Christmas Reindeer
Detail of Christmas tree charm on red and green elastic hair tie for holiday hair styling - Christmas Tree
Festive Christmas hair tie with Santa Claus charm and durable red green elastic rope - Santa Claus
+1
Christmas Hair Ties Elastic Ponytail Holders With Plastic Resin Santa Claus Snowman Reindeer Tree Charms Holiday Accessory
-5%
$0.16
Mix MOQ : 2
 · 
68 sold recently
Christmas Tree Hanging Ornaments Red White Plastic Lollipop Reindeer Snowman Star Glitter Holiday Party Decor
Christmas Tree Hanging Ornaments Red White Plastic Lollipop Reindeer Snowman Star Glitter Holiday Party Decor
like
Find Similar
6-piece set of red and white Christmas candy cane ornaments in clear packaging box - Lollipop (6 pieces/box)
Detail of red Christmas star ornaments with white dots and size dimensions - Five-pointed Star Santa (3 pieces/box)
Glittery red and white ice cream cone Christmas tree ornaments with gold hanging loops - Ice Cream (3 pieces/box)
Christmas red elk reindeer hanging ornament set with white antlers and size measurements - Reindeer (3 pieces/box)
+1
Christmas Tree Hanging Ornaments Red White Plastic Lollipop Reindeer Snowman Star Glitter Holiday Party Decor
$1.73-2.31
No MOQ
 · 
27 views
Christmas Window Stickers Static Cling PVC Santa Snowman Reindeer Snowflake Glass Showcase Festive Decoration Removable
Christmas Window Stickers Static Cling PVC Santa Snowman Reindeer Snowflake Glass Showcase Festive Decoration Removable
like
Find Similar
Blue snowflake and star Christmas window stickers with various sizes for glass decor - BQ012 White Snowflakes (Many Elements)
Detailed size specifications for blue snowflake stencil for Christmas party decorations - BQ013 White Snowflakes (Classic)
Detailed dimensions of Santa Claus elk static stickers and snowflakes for glass window decor - BQ018 White Snowflakes (4 Sheets Set)
Christmas Santa Claus and gift box window stickers set with dimensions 20x30cm - BQ125 Santa Claus & Reindeer
+22
Christmas Window Stickers Static Cling PVC Santa Snowman Reindeer Snowflake Glass Showcase Festive Decoration Removable
$0.32-2.02
Mix MOQ : 2
Christmas Decorative Lantern Vintage LED Night Light Ornament Santa Snowman Plastic Micro Landscape Holiday Desktop Decor
Christmas Decorative Lantern Vintage LED Night Light Ornament Santa Snowman Plastic Micro Landscape Holiday Desktop Decor
like
Find Similar
Vintage bronze Christmas lantern with Santa Claus and tree scene, decorative LED light - No Water Bronze Santa Claus
Vintage bronze Christmas LED lantern with a snowman miniature and festive red decorations - No Water Bronze Snowman
Bronze vintage Christmas lantern with internal Christmas tree and warm LED lighting - No Water Bronze Christmas Tree
Bronze vintage LED lantern with interior miniature figurine and metallic finish - No Water Bronze Angel
Christmas Decorative Lantern Vintage LED Night Light Ornament Santa Snowman Plastic Micro Landscape Holiday Desktop Decor
$1.87
No MOQ
 · 
48 sold recently
Christmas Acrylic Drop Earrings Snowman Tree Boots Cup Glitter Festive Novelty Jewelry Women Stainless Steel Earring Post
Christmas Acrylic Drop Earrings Snowman Tree Boots Cup Glitter Festive Novelty Jewelry Women Stainless Steel Earring Post
like
Find Similar
Detail view of festive snowman earrings with size measurements of 6.0cm by 2.8cm - Round Snowman (WEH3572)
Close-up of festive acrylic Christmas mug earrings with glitter snowflake detailing - Mug (WEH3567)
Macro detail of Christmas glove acrylic earrings with glitter snowflake and green disk - Red Gloves (WEH3568)
Colorful acrylic Christmas tree and Santa hat earrings with glitter and snowflakes - Christmas Tree & Hat (WEH3569)
Christmas Acrylic Drop Earrings Snowman Tree Boots Cup Glitter Festive Novelty Jewelry Women Stainless Steel Earring Post
-5%
$0.75-1.24
No MOQ
 · 
55 sold recently
Free Shipping
Christmas Window Clings Static PVC Stickers Double Sided Santa Claus Reindeer Snowman Snowflakes Glass Decor
Christmas Window Clings Static PVC Stickers Double Sided Santa Claus Reindeer Snowman Snowflakes Glass Decor
like
Find Similar
Detailed sheet of 9 Christmas window stickers featuring Santa Claus and reindeer designs - Christmas Window Clings A01 (268pcs)
9-sheet set of 162 3D Christmas window clings featuring Santa, snowmen, and reindeer patterns - Christmas Window Clings A02 (162pcs)
Detailed size chart for Christmas window stickers featuring reindeer and Santa Claus motifs - Christmas Window Clings A03 (227pcs)
Christmas static window decals set featuring Santa, reindeer and snowflakes in 9 sheets - Christmas Window Clings A04 (245pcs)
+18
Christmas Window Clings Static PVC Stickers Double Sided Santa Claus Reindeer Snowman Snowflakes Glass Decor
-4%
$2.33
No MOQ
Christmas Stud Earrings Stainless Steel 14K Gold Plated Enamel Santa Claus Snowman Tree Holiday Jewelry For Women
Christmas Stud Earrings Stainless Steel 14K Gold Plated Enamel Santa Claus Snowman Tree Holiday Jewelry For Women
like
Find Similar
Christmas reindeer hat studs size detail: 1.1cm height, 1.3cm width, 2.0g weight gold plated - Red Hat Reindeer Horns
Christmas tree stud earrings with red and green enamel in 1.3cm x 1.0cm gold frame - Red Christmas Tree
Detail showing red oil-dripped Christmas stocking stud earrings with gold star pattern - Christmas Sock
Detailed view of Christmas tree earrings with green oil drip finish and size dimensions - Green Christmas Tree
+17
Christmas Stud Earrings Stainless Steel 14K Gold Plated Enamel Santa Claus Snowman Tree Holiday Jewelry For Women
-5%
$0.99-5.97
No MOQ
 · 
17 views
Free Shipping
Christmas Throw Pillow Cover Linen Watercolor Santa Snowman Print Square Decorative Cushion Case For Sofa Home Decor
Christmas Throw Pillow Cover Linen Watercolor Santa Snowman Print Square Decorative Cushion Case For Sofa Home Decor
like
Find Similar
Christmas Santa Claus cushion cover with thumbs up print on linen pillowcase - Thumbs Up Santa Claus / 45*45cm Single-sided Linen
Linen Christmas pillow case featuring a hand-painted snowman illustration with a red scarf - Snowman with Branch Arms / 45*45cm Single-sided Linen
Linen Christmas pillowcase featuring a watercolor snowman with hat and scarf on white backdrop - Snowman with Wide Brim Hat / 45*45cm Single-sided Linen
Linen Christmas pillow cover with red cardinal and berry watercolor print on beige background - Red Cardinal Bird / 45*45cm Single-sided Linen
+17
Christmas Throw Pillow Cover Linen Watercolor Santa Snowman Print Square Decorative Cushion Case For Sofa Home Decor
$1.30
Mix MOQ : 2
Christmas Hanging Ornaments Resin Snowman Santa Claus Reindeer Sleigh Stocking Holiday Tree Pendant Decor
Christmas Hanging Ornaments Resin Snowman Santa Claus Reindeer Sleigh Stocking Holiday Tree Pendant Decor
like
Find Similar
Red resin Christmas house ornament with snow details and twine, size 7x6cm, weight 23g - Snow House
Blue Christmas stocking resin pendant with gift box and star tree hanging decoration - Christmas Stocking Bag
Christmas snowman gift bag resin hanging ornament with Let It Snow text and red finish - Snowman Gift Bag
Resin Santa Claus hanging ornament with gift bag for Christmas tree decoration - Santa with Gift Bags
+17
Christmas Hanging Ornaments Resin Snowman Santa Claus Reindeer Sleigh Stocking Holiday Tree Pendant Decor
-5%
$1.31-3.26
Mix MOQ : 2
Free Shipping
Merry Christmas Banner Outdoor Yard Decoration Oxford Cloth Santa Claus Snowman Plaid Hanging Flag For Holiday Party Wall
Merry Christmas Banner Outdoor Yard Decoration Oxford Cloth Santa Claus Snowman Plaid Hanging Flag For Holiday Party Wall
like
Find Similar
Red Merry Christmas banner with Santa Claus and gift box illustrations for holiday decor - 001 Red Santa Train Style / 300*50cm
Buffalo plaid Christmas banner with Merry Christmas text and white reindeer silhouettes - 002 Red and Black Buffalo Plaid Style / 300*50cm
Merry Christmas banner with Santa Claus and snowflakes in red and blue color block - 003 Red and Blue Snowflake Splicing / 300*50cm
Red Merry Christmas banner with Santa Claus train and festive tree decorations - 004 Red Cartoon Train and Tree / 300*50cm
+17
Merry Christmas Banner Outdoor Yard Decoration Oxford Cloth Santa Claus Snowman Plaid Hanging Flag For Holiday Party Wall
$4.32
Mix MOQ : 2
Christmas Gift Bags Santa Claus Snowman Reindeer Burlap Plush Fabric Drawstring Candy Apple Packing Holiday Decor
Christmas Gift Bags Santa Claus Snowman Reindeer Burlap Plush Fabric Drawstring Candy Apple Packing Holiday Decor
like
Find Similar
Green Santa Claus gift bag with heart window and 29cm height for Christmas apples - AFLD3-1 Green Santa Claus 29cm
Green burlap reindeer Christmas gift bag with a heart-shaped window and plaid scarf - AFLD3-3 Green Reindeer 17x29cm
Red Christmas Santa gift bag with a heart-shaped transparent window and 17x29 cm size - AFLD3-4 Red Santa Claus 17x29cm
Brown reindeer felt Christmas gift bag with white fur trim and red drawstrings - AFLD4-1 Coffee Reindeer 14.5x15cm
+17
Christmas Gift Bags Santa Claus Snowman Reindeer Burlap Plush Fabric Drawstring Candy Apple Packing Holiday Decor
-5%
$1.89-8.77
No MOQ
Free Shipping
Christmas Chair Covers Plush Fabric Non-Woven Santa Snowman Reindeer Pattern Plaid Sequined Home Party Festive Decoration
Christmas Chair Covers Plush Fabric Non-Woven Santa Snowman Reindeer Pattern Plaid Sequined Home Party Festive Decoration
like
Find Similar
Christmas snowman chair cover with red black plaid pattern and plush nose 52x47cm - Snowman
Santa Claus Christmas chair cover in red and white plush fabric with 52x47cm dimensions - Santa Claus
Christmas reindeer chair cover in brown plush with festive plaid pattern, size 52x47cm - Reindeer
Champagne gold gnome chair cover with sequins and Merry Christmas embroidery for Christmas decor - Beige Sequin Gnome Santa Chair Cover
+17
Christmas Chair Covers Plush Fabric Non-Woven Santa Snowman Reindeer Pattern Plaid Sequined Home Party Festive Decoration
-10%
$3.60-5.48
No MOQ
Festive Christmas Pillowcase Cartoon Santa Claus Snowman Printed Peach Skin Decorative Cushion Cover Home Sofa Throw Pillowcase
Festive Christmas Pillowcase Cartoon Santa Claus Snowman Printed Peach Skin Decorative Cushion Cover Home Sofa Throw Pillowcase
like
Find Similar
Christmas snowman and red bird print pillow cover in peach skin fabric for home decor - Snowman and Red Birds Winter Illustration (tpr-1)
Detail of Christmas pillow cover featuring snowman family and puppy on snow forest - Snowman Family and Puppy Illustration (tpr-2)
Cartoon snowman and farm scene print square throw pillowcase in blue and red - Snowman and Red Tractor Winter Farm Illustration (tpr-3)
Christmas snowman and cardinal bird throw pillow cover with Stay Warm text print - Snowman and Red Bird Winter Christmas Illustration (tpr-4)
+35
NewFestive Christmas Pillowcase Cartoon Santa Claus Snowman Printed Peach Skin Decorative Cushion Cover Home Sofa Throw Pillowcase
-5%
$1.04
Mix MOQ : 2
Christmas Linen Throw Pillow Covers Santa Snowman Reindeer Gingerbread Man Decorative Cushion Case For Sofa Couch Home Decor
Christmas Linen Throw Pillow Covers Santa Snowman Reindeer Gingerbread Man Decorative Cushion Case For Sofa Couch Home Decor
like
Find Similar
Linen Christmas pillowcase featuring forest deer silhouettes and rustic wood grain pattern - Forest Deer (1)
Christmas Tree Farm linen pillowcase with retro wood grain background on sofa - Christmas Tree Farm (2)
Christmas cushion cover with Sleigh Rides and Hot Cocoa print on faux wood linen - Vintage Sleigh And Cocoa (3)
Christmas gingerbread man linen cushion cover on grey sofa with postcard design - Gingerbread Postcard (4)
+14
Christmas Linen Throw Pillow Covers Santa Snowman Reindeer Gingerbread Man Decorative Cushion Case For Sofa Couch Home Decor
-4%
$1.18
No MOQ
Christmas Hair Claw Clips PVC Santa Claus Snowman Patterns Large Red Festive Holiday Headwear For Women Girls
Christmas Hair Claw Clips PVC Santa Claus Snowman Patterns Large Red Festive Holiday Headwear For Women Girls
like
Find Similar
Detail of red Christmas hair claw clip with Santa Claus pattern and snowflake prints - Style E (Santa & Mrs. Claus)
Detail of red Christmas hair claw clip with Santa Claus, snowmen and snowflake patterns - Style B (Santa & Snowman)
Detail of red Christmas hair claw clip with snowflake pattern and Santa Claus motif - Style D (Santa & Snowflake Pattern)
Red Christmas shark hair clip with Santa Claus and tree motifs for ponytail styling - Style C (Xmas Tree & Candy Cane)
+1
Christmas Hair Claw Clips PVC Santa Claus Snowman Patterns Large Red Festive Holiday Headwear For Women Girls
$1.15
No MOQ
 · 
391 sold recently
Christmas Cushion Cover Peach Skin Polyester Pillowcase For Sofa Decor Santa Claus Elk Snowman Festive Holiday Pillow Case
Christmas Cushion Cover Peach Skin Polyester Pillowcase For Sofa Decor Santa Claus Elk Snowman Festive Holiday Pillow Case
like
Find Similar
Red Christmas pillow cover with gold stars and white Merry Christmas text Style-E - Style-E (Red Gold Stars Merry Christmas)
Christmas 18x18 inch pillow cover with gold bells and Merry Christmas greeting - Style-1 (Gold Bells Holly Leaves)
Style-G red Christmas pillowcase with star light frame and pine branch pattern - Style-G (Red Pentagram Light Frame)
Christmas Santa and reindeer sleigh peach skin velvet pillow cover 45x45cm - Style-4 (Santa Claus Reindeer Sleigh)
+42
Christmas Cushion Cover Peach Skin Polyester Pillowcase For Sofa Decor Santa Claus Elk Snowman Festive Holiday Pillow Case
$1.10
No MOQ
Christmas Series Zinc Alloy Enamel Keychain Pendant Santa Claus Snowman Reindeer Christmas Tree Bag Hanging Ornament Gift
Christmas Series Zinc Alloy Enamel Keychain Pendant Santa Claus Snowman Reindeer Christmas Tree Bag Hanging Ornament Gift
like
Find Similar
Christmas snowman keychain pendant with colorful enamel finish and gold metal ring - Snowman With Red And White Hat Style (15)
Christmas stocking keychain pendant with gingerbread man design in red alloy finish - Christmas Sock With Gingerbread Man Style (16)
Christmas snowman keychain with red hat and scarf on gold alloy base for bags - Snowman With Red Hat Style (1)
Christmas reindeer keychain with gold lobster clasp and white enamel deer charm - White Face Reindeer With Red Antlers Style (2)
+12
Christmas Series Zinc Alloy Enamel Keychain Pendant Santa Claus Snowman Reindeer Christmas Tree Bag Hanging Ornament Gift
-10%
$0.52
Mix MOQ : 10
Christmas Luminous Snowman Reindeer Decoration LED Light White Plush Iron Holiday Home Yard Ornament
Christmas Luminous Snowman Reindeer Decoration LED Light White Plush Iron Holiday Home Yard Ornament
like
Find Similar
Medium size glowing white plush reindeer Christmas decoration with lights, 48x101cm - 100CM Reindeer
Plush white reindeer Christmas ornament with LED lights and pinecone detail 35x74cm - 74CM Reindeer
Luminous 135cm white reindeer Christmas decoration with LED lights and pine cone accents - 135CM Reindeer
75cm glowing plush snowman decoration with red hat and scarf for Christmas decor - 75CM Snowman with Red Scarf
+3
Christmas Luminous Snowman Reindeer Decoration LED Light White Plush Iron Holiday Home Yard Ornament
-5%
$32.31-67.90
No MOQ
Plush Snowman Christmas Tree Ornaments Hanging Pendants Soft Knit Scarf Hat Festive Holiday Home Decor Cute Winter Gifts
Plush Snowman Christmas Tree Ornaments Hanging Pendants Soft Knit Scarf Hat Festive Holiday Home Decor Cute Winter Gifts
like
Find Similar
Plush snowman Christmas tree ornament with red and white knit scarf and hat, 12cm - Snowman Style C / 18.6g/Piece
Plush snowman Christmas tree ornament with red scarf hanging on a warm lit tree - Snowman Type A / 14.7g/Piece
Plush snowman Christmas ornament with red hat and scarf hanging on a festive tree branch - Snowman Style B / 17g/Piece
Plush Snowman Christmas Tree Ornaments Hanging Pendants Soft Knit Scarf Hat Festive Holiday Home Decor Cute Winter Gifts
$3.69
Mix MOQ : 3
 · 
46 sold recently
Free Shipping
Festive Zinc Alloy Christmas Keychain Rhinestone Enamel Santa Claus Tree Bell Snowman Metal Keyring Bag Pendant Decoration Holiday Gift
Festive Zinc Alloy Christmas Keychain Rhinestone Enamel Santa Claus Tree Bell Snowman Metal Keyring Bag Pendant Decoration Holiday Gift
like
Find Similar
Cute pearl snowman keychain with red enamel hat and gold lobster clasp for bags - Christmas Pearl Snowman
Golden Christmas tree keychain with red enamel and sparkling white crystals - Red Christmas Tree
Exquisite crystal Christmas tree keychain with colorful rhinestones and gold ring - Christmas Tree Style
Rockstar Santa Claus keychain with red rhinestones and a blue guitar in gold finish - Guitar Santa Style
+8
Festive Zinc Alloy Christmas Keychain Rhinestone Enamel Santa Claus Tree Bell Snowman Metal Keyring Bag Pendant Decoration Holiday Gift
-13%
$1.62
No MOQ
Christmas Gift Bags Reusable Non-Woven Fabric Large Portable Holiday Shopping Tote Santa Snowman Printed Festive Decor
Christmas Gift Bags Reusable Non-Woven Fabric Large Portable Holiday Shopping Tote Santa Snowman Printed Festive Decor
like
Find Similar
Red Christmas non-woven gift bag with Santa and Snowman prints for holiday shopping - 32.5*25*17cm / Red (Style 2)
Blue non-woven Christmas gift bag with Santa Claus, Snowman and Merry Christmas prints - 32.5*25*17cm / Blue (Style 1)
Large Merry Christmas non-woven gift bag with Santa Claus and reindeer printing - 32.5*25*17cm / Blue (Style 3)
Christmas non-woven gift bag in dark green featuring Santa Claus and reindeer patterns - 32.5*25*17cm / Dark Green (Style 4)
+2
Christmas Gift Bags Reusable Non-Woven Fabric Large Portable Holiday Shopping Tote Santa Snowman Printed Festive Decor
-4%
$0.44
No MOQ
 · 
16 views
Christmas Plush Toys Soft Stuffed Santa Claus Reindeer Snowman Dolls Holiday Home Decor Festive Gifts For Kids
Christmas Plush Toys Soft Stuffed Santa Claus Reindeer Snowman Dolls Holiday Home Decor Festive Gifts For Kids
like
Find Similar
Cute plush Santa Claus doll with Merry Christmas hat on wooden table with holiday lights - Santa Claus / 23CM
Close-up of plush Christmas reindeer toy with Merry Christmas ribbon and red hat - Christmas Reindeer Blue / 23CM
Plush Christmas snowman with Happy Christmas embroidery and cozy festive holiday background - Snowman / 23CM
+3
Christmas Plush Toys Soft Stuffed Santa Claus Reindeer Snowman Dolls Holiday Home Decor Festive Gifts For Kids
$2.88-4.90
Mix MOQ : 3
 · 
49 sold recently
Christmas Winter Snow Scene Pillowcase Peach Skin Fabric Decorative Cushion Cover For Sofa Living Room Home Decor Oil Painting Style Robin Snowman Pattern
Christmas Winter Snow Scene Pillowcase Peach Skin Fabric Decorative Cushion Cover For Sofa Living Room Home Decor Oil Painting Style Robin Snowman Pattern
like
Find Similar
Winter snow scene pillowcase with retro street lamp and robin on peach skin fabric - Vintage Street Lamp Robin Style (1)
Detail of Christmas pillow cover with oil painting style wreath on a white door - Christmas Wreath White Door Style (2)
Close-up of Christmas pillow cover with robin bird and snowy church oil painting - Robin Church in Snow Style (3)
Square peach skin pillowcase with winter snow scene oil painting and Christmas tree - Winter Cottage and Street Lamp Style (4)
+36
Christmas Winter Snow Scene Pillowcase Peach Skin Fabric Decorative Cushion Cover For Sofa Living Room Home Decor Oil Painting Style Robin Snowman Pattern
-4%
$1.04
No MOQ
Festive Christmas Santa Pants Gift Bags With Snowman Reindeer Designs For Candy Storage And Holiday Party Decor
Festive Christmas Santa Pants Gift Bags With Snowman Reindeer Designs For Candy Storage And Holiday Party Decor
like
Find Similar
Creative red Santa pants gift bag with black belt and handle for Christmas candy - Santa Claus Small
Detailed close-up of a festive red felt Christmas gift bag featuring a 3D snowman and belt - Snowman with Tie Small
Detail of red Santa pants gift bag with snowman doll and white snowflake patterns - White Snowman Small
Felt Christmas gift bag in Santa pants shape with cute reindeer and snowflake decor - White Reindeer Small
+14
Festive Christmas Santa Pants Gift Bags With Snowman Reindeer Designs For Candy Storage And Holiday Party Decor
$1.07-1.67
No MOQ
Vintage Christmas Fridge Magnet Crystal Glass Round Magnetic Refrigerator Sticker Postcard Santa Reindeer Snowman Decor
Vintage Christmas Fridge Magnet Crystal Glass Round Magnetic Refrigerator Sticker Postcard Santa Reindeer Snowman Decor
like
Find Similar
25mm round glass Christmas magnet with vintage Santa postcard design and magnetic back - Santa Claus And Child (JY008617-1)
Round Christmas fridge magnet with vintage postcard elf illustration and magnetic back - Christmas Angel (JY008617-2)
Vintage post card style glass fridge magnet with girl and reindeer illustration - Girl And Reindeer (JY008617-3)
30mm crystal glass Christmas fridge magnet with reindeer postcard design and strong magnet - Running Reindeer (JY008617-4)
+8
NewVintage Christmas Fridge Magnet Crystal Glass Round Magnetic Refrigerator Sticker Postcard Santa Reindeer Snowman Decor
$0.20
No MOQ
Christmas Wreath Handmade Plush Wool Felt LED Light Reindeer Snowman Decor Holiday Home Hanging Ornament Nordic Style
Christmas Wreath Handmade Plush Wool Felt LED Light Reindeer Snowman Decor Holiday Home Hanging Ornament Nordic Style
like
Find Similar
Pink plush reindeer wreath donut 25cm diameter for Christmas home decor - 25CM Pink Ring
30cm beige plush donut Christmas wreath made of soft faux fur for holiday decoration - 30CM White Ring
Pink plush donut wreath decor with 30cm diameter and soft furry wool felt texture - 30CM Pink Ring
Plush white doughnut wreath ornament with soft spiral texture for Christmas decor, 25cm - 25CM White Ring
+1
Christmas Wreath Handmade Plush Wool Felt LED Light Reindeer Snowman Decor Holiday Home Hanging Ornament Nordic Style
-5%
$4.87-18.84
No MOQ
 · 
11 views
Stainless Steel Enamel Christmas DIY Pendants Snowman Reindeer Santa Hat Candy Cane Socks House Charms Jewelry Making Accessories
Stainless Steel Enamel Christmas DIY Pendants Snowman Reindeer Santa Hat Candy Cane Socks House Charms Jewelry Making Accessories
like
Find Similar
Detail view of a Christmas snowman pendant with dimensions 1.2cm x 1.4cm and weight 0.9g - Snowman (BP00044A)
Detailed view of skull crown enamel charm for DIY jewelry with 1.5cm height measurements - Skull (BP0000103BW)
Detailed view of enamel ghost charm with dimensions 1.1x1.3cm and 1.0g weight info - Ghost (BP0000104BW)
Detail of Christmas candy cane pendant with red and green enamel and dimensions - Candy Cane Silver Edge (BP00128A)
+22
Stainless Steel Enamel Christmas DIY Pendants Snowman Reindeer Santa Hat Candy Cane Socks House Charms Jewelry Making Accessories
-6%
$0.47-1.20
No MOQ
Free Shipping
Christmas LED Glowing Glasses Light Up Party Eyewear For Festival Celebration Santa Reindeer Snowman Plastic Novelty Decorations
Christmas LED Glowing Glasses Light Up Party Eyewear For Festival Celebration Santa Reindeer Snowman Plastic Novelty Decorations
like
Find Similar
Christmas LED light-up glasses featuring Merry Christmas text and festive patterns - Transparent Frame Santa Style (Style A) / LED Glowing
LED Merry Christmas glasses in red frame featuring Santa and reindeer, 15.6cm wide - Red Sequined Santa Style (Style B) / LED Glowing
LED Merry Christmas reindeer party glasses in red plastic with festive felt decorations - Red Christmas Tree Candy Style (Style C) / LED Glowing
Christmas LED light-up glasses featuring Jingle Bells Santa and candy cane decor - Transparent Frame Christmas Bell Style (Style D) / LED Glowing
+8
Christmas LED Glowing Glasses Light Up Party Eyewear For Festival Celebration Santa Reindeer Snowman Plastic Novelty Decorations
-4%
$1.15
Mix MOQ : 2
Christmas Hanging Ornaments Plush Burlap Santa Snowman Reindeer Bear Dolls With Plaid Hat And Dangling Legs Tree Decor
Christmas Hanging Ornaments Plush Burlap Santa Snowman Reindeer Bear Dolls With Plaid Hat And Dangling Legs Tree Decor
like
Find Similar
Detail of plush Santa ornament with red burlap texture and faux fur on a wooden table - Large Santa
Christmas snowman plush ornament in red green plaid and burlap on a wooden table - Large Snowman
Detailed view of burlap Christmas reindeer ornament with a red and green plaid scarf - Large Size Reindeer
Detailed view of burlap Christmas bear ornament with plush fur on a rustic wooden desk - Large Bear
+8
Christmas Hanging Ornaments Plush Burlap Santa Snowman Reindeer Bear Dolls With Plaid Hat And Dangling Legs Tree Decor
$0.49-0.58
No MOQ
Christmas Chair Covers Pink Plush Santa Snowman Reindeer Extending Dolls Candy Baskets Desktop Decoration Ornaments
Christmas Chair Covers Pink Plush Santa Snowman Reindeer Extending Dolls Candy Baskets Desktop Decoration Ornaments
like
Find Similar
Detailed close-up of a pink sequin Santa chair cover with faux fur and checkered patterns - Pink Santa Claus Chair Cover
Detailed view of pink plaid Christmas chair cover with cute snowman face and scarf decor - Pink Snowman Chair Cover
Detail of pink Christmas reindeer chair cover with plush fabric and sequined scarf accent - Pink Reindeer Chair Cover
Detail of pink Christmas gnome featuring sequin hat, long legs, and white faux fur trim - Pink Telescopic Santa
+8
Christmas Chair Covers Pink Plush Santa Snowman Reindeer Extending Dolls Candy Baskets Desktop Decoration Ornaments
$2.16-6.34
No MOQ
Christmas Grosgrain Ribbon Large Bow Hair Ties Snowman Santa Print Elastic Ponytail Holders Girls Holiday Accessories
Christmas Grosgrain Ribbon Large Bow Hair Ties Snowman Santa Print Elastic Ponytail Holders Girls Holiday Accessories
like
Find Similar
Detail of Christmas grosgrain ribbon hair bow with snowman prints and elastic band - 1# Snowman Print
Detail of Christmas ribbon bow hair tie featuring Santa and tree patterns on white fabric - 2# Santa Claus
Macro detail of Christmas grosgrain bow with Santa and snowman patterns on elastic tie - 13# Gradient Festive Mix
Detail of Christmas bow with Santa and candy cane patterns on white grosgrain ribbon - 3# Festive Candy Cane
+8
Christmas Grosgrain Ribbon Large Bow Hair Ties Snowman Santa Print Elastic Ponytail Holders Girls Holiday Accessories
-13%
$0.45
No MOQ
 · 
12 views
Christmas Cushion Cover Short Plush Velvet Snowman Christmas Tree Print Decorative Pillowcase Home Sofa Decor
Christmas Cushion Cover Short Plush Velvet Snowman Christmas Tree Print Decorative Pillowcase Home Sofa Decor
like
Find Similar
Christmas pillow cover with Nordic snowflake patterns in red and teal festive colors - Nordic Stripe Snowflake (CDR354-1) / 45x45cm Single-sided No Insert
Christmas pillowcase with red and white geometric tree pattern on dark blue fabric - Dark Blue Geometric Xmas Tree (CDR354-2) / 45x45cm Single-sided No Insert
Square dark blue Christmas pillow cover featuring festive colorful ornaments and snowflakes - Dark Blue Xmas Ball Snowflake (CDR354-3) / 45x45cm Single-sided No Insert
Navy blue Christmas pillowcase with festive stocking and gift box patterns - Dark Blue Xmas Sock Gift Box (CDR354-4) / 45x45cm Single-sided No Insert
+8
Christmas Cushion Cover Short Plush Velvet Snowman Christmas Tree Print Decorative Pillowcase Home Sofa Decor
$1.30
Mix MOQ : 2
Christmas Metal Hanging Ornaments Bells Angel Pendants Painted Santa Snowman Rustic Holiday Tree Decor With Hemp Rope
Christmas Metal Hanging Ornaments Bells Angel Pendants Painted Santa Snowman Rustic Holiday Tree Decor With Hemp Rope
like
Find Similar
8cm vintage dark green metal Christmas bell with snowman design and rustic hanging rope - Diameter 8cm / 8cm Green Bell
White frosted metal Christmas bell ornament with Santa illustration and star cutout - Diameter 8cm / 8cm White Bell
Red 8cm vintage metal Christmas bell featuring snowman print and hollow star cutouts - Diameter 8cm / 8cm Red Bell
5.5cm vintage metal Christmas bell with Santa pattern and twine hanging loop - Diameter 5.5cm / 6cm Green Bell
+8
Christmas Metal Hanging Ornaments Bells Angel Pendants Painted Santa Snowman Rustic Holiday Tree Decor With Hemp Rope
$1.43-2.07
No MOQ
Free Shipping
Christmas Gift Bag Linen Fabric With 3D Santa Snowman Reindeer Drawstring Candy Pouch For Holiday Party Decor
Christmas Gift Bag Linen Fabric With 3D Santa Snowman Reindeer Drawstring Candy Pouch For Holiday Party Decor
like
Find Similar
Christmas reindeer gift bag with red snowflake patterns and JOY text, 15x22 cm size - Reindeer Apple Bag A / 15*22 cm
Green burlap Christmas gift bag with 3D Santa Claus and red drawstring, size 33x55 cm - Santa Claus Gift Bag (Large) / 33*55 cm
Red 33x55cm Christmas reindeer gift bag with plush decoration and XMAS embroidery - Reindeer Gift Bag (Large) / 33*55 cm
Red Santa Claus Christmas gift bag for candy and apples, size 17x37cm festive design - Santa Claus Apple Bag B / 17*37 cm
+8
Christmas Gift Bag Linen Fabric With 3D Santa Snowman Reindeer Drawstring Candy Pouch For Holiday Party Decor
-5%
$5.20-7.94
No MOQ
Free Shipping
Plush Christmas Hanging Ornaments Santa Snowman Reindeer Bear Figures Long Bead Legs Plaid Hats Xmas Tree Decoration
Plush Christmas Hanging Ornaments Santa Snowman Reindeer Bear Figures Long Bead Legs Plaid Hats Xmas Tree Decoration
like
Find Similar
Close-up of a felt Christmas reindeer ornament with scarf, buttons, and wooden clip detail - New Chain Leg Reindeer
Detail of Christmas bear ornament with red plaid hat and green felt body on a tree - New Chain Leg Bear
Detail of Santa plush ornament with red plaid hat and long dangling legs for Christmas tree - Black Ball Hanging Santa
Detail of plush Christmas snowman ornament with red checkered hat and silver beaded legs - Black Ball Hanging Snowman
+8
Plush Christmas Hanging Ornaments Santa Snowman Reindeer Bear Figures Long Bead Legs Plaid Hats Xmas Tree Decoration
-5%
$0.52
No MOQ
Christmas Headband Non-Woven Fabric Spring Santa Snowman Reindeer Xmas Party Favor Holiday Hair Hoop Cosplay Decoration
Christmas Headband Non-Woven Fabric Spring Santa Snowman Reindeer Xmas Party Favor Holiday Hair Hoop Cosplay Decoration
like
Find Similar
Christmas headband with 3D Santa Claus figures in red fabric, size 25x12CM for parties - Santa Claus Spring Headband
Christmas snowman headband with red spring design for kids party gift, 25x12cm size - Snowman Spring Headband
Christmas reindeer antler headband with white fur and red bows, size 25x12cm - Reindeer Spring Headband
Christmas party headband with plush white bears wearing red hats and bows, 25x12cm - Bear Spring Headband
+4
Christmas Headband Non-Woven Fabric Spring Santa Snowman Reindeer Xmas Party Favor Holiday Hair Hoop Cosplay Decoration
-4%
$0.47
No MOQ
 · 
229 sold recently
Christmas Ball Ornaments Painted Plastic Baubles For Tree Hanging Decoration Holiday Scene Layout Reindeer Snowman Pattern Vintage Style
Christmas Ball Ornaments Painted Plastic Baubles For Tree Hanging Decoration Holiday Scene Layout Reindeer Snowman Pattern Vintage Style
like
Find Similar
8cm Christmas ball ornament with bells pattern, red ribbon hanger, weighing 11g - Bells and Green Leaves
Red 8cm Christmas ball ornament with snowflake patterns and silk bow hanging loop - Striped Christmas Tree
White 8cm Christmas ball ornament with red car illustration and silk ribbon bow - Red with White Car
Red Christmas ball ornament with vintage car pattern and green satin ribbon bow - White with Red Car
+4
Christmas Ball Ornaments Painted Plastic Baubles For Tree Hanging Decoration Holiday Scene Layout Reindeer Snowman Pattern Vintage Style
-5%
$1.01-17.01
No MOQ
Christmas Tree Ornaments Cute Cartoon Santa Snowman Reindeer Bear Hanging Dolls Linen Plush Plaid Home Party Decor
Christmas Tree Ornaments Cute Cartoon Santa Snowman Reindeer Bear Hanging Dolls Linen Plush Plaid Home Party Decor
like
Find Similar
Miniature Christmas snowman ornament with red and black plaid hat on a glowing tree - Checkered Cloth Snowman
Miniature Santa Claus plush ornament made of red burlap and white felt with golden string - Burlap Doll Santa Claus
Christmas teddy bear ornament with red plaid scarf and grey hat for tree decoration - Khaki Bear Burlap Doll
Brown plush Christmas bear ornament wearing a red and black plaid suit on a tree - Grid Cloth Khaki Bear
+4
Christmas Tree Ornaments Cute Cartoon Santa Snowman Reindeer Bear Hanging Dolls Linen Plush Plaid Home Party Decor
-5%
$0.52
No MOQ
Christmas Felt Ornaments Handmade Wool Snowman Reindeer Gnome Owl Desktop Decoration Festive Home Party Photography Props Nordic Style
Christmas Felt Ornaments Handmade Wool Snowman Reindeer Gnome Owl Desktop Decoration Festive Home Party Photography Props Nordic Style
like
Find Similar
Handmade brown wool felt Christmas reindeer figurine with pink scarf and saddle ornament - Style 9 (Brown Reindeer with Pink Scarf)
Felt reindeer doll with red scarf and plaid vest on wooden base for Christmas - Style 7 (Grey White Deer with Plaid Vest & Wood Base)
Handmade Christmas felt reindeer figurine with red scarf and embroidery style 8 - Style 8 (White Reindeer with Red Embroidery Bag)
Handmade wool felt Santa Claus figurine with red hat and white beard Christmas decor - Style 4 (Santa Claus Red Wool Felt)
+4
Christmas Felt Ornaments Handmade Wool Snowman Reindeer Gnome Owl Desktop Decoration Festive Home Party Photography Props Nordic Style
-5%
$6.57-12.05
No MOQ
Free Shipping
Christmas Slap Bracelet Luminous LED Light Up Cartoon Santa Snowman Plush Wrist Band Holiday Party Favors For Kids
Christmas Slap Bracelet Luminous LED Light Up Cartoon Santa Snowman Plush Wrist Band Holiday Party Favors For Kids
like
Find Similar
LED Santa Claus Christmas snap bracelet in red plush fabric on festive wooden desk - Red Santa Claus (With LED)
Luminous red Santa slap bracelet with LED light and soft plush fabric for Christmas decor - Red Snowman (With LED)
Luminous Santa Claus slap bracelet in red velvet with LED lights for Christmas decor - Red Reindeer (With LED)
LED Christmas slap bracelet featuring plush Santa Claus on a festive wooden background - Red Bear (With LED)
+4
Christmas Slap Bracelet Luminous LED Light Up Cartoon Santa Snowman Plush Wrist Band Holiday Party Favors For Kids
-4%
$0.23-0.61
No MOQ
 · 
28 sold recently
Christmas Beaded Bracelet Copper Chain Alloy Beads Glazed Glass Snowman Tree Bell Charms Snake Bone Jewelry Women
Christmas Beaded Bracelet Copper Chain Alloy Beads Glazed Glass Snowman Tree Bell Charms Snake Bone Jewelry Women
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - 18cm/Silver Basic Chain
Christmas charm bracelet with green and red glass beads and a silver snake chain - SD-0034/Christmas Red & Green Beaded
Christmas beaded bracelet with green glass beads and silver Santa tree charms - SD-0013/Green Christmas Tree Beaded
Christmas charm bracelet with red crystal beads, silver snake chain, and bell pendants - SD-0030/Red Snowman Beaded
+4
Christmas Beaded Bracelet Copper Chain Alloy Beads Glazed Glass Snowman Tree Bell Charms Snake Bone Jewelry Women
$0.73-3.14
No MOQ
Free Shipping
Christmas Theme Dangle Earrings Resin Alloy Cartoon Santa Claus Snowman Tree Bell Cute Holiday Jewelry For Women
Christmas Theme Dangle Earrings Resin Alloy Cartoon Santa Claus Snowman Tree Bell Cute Holiday Jewelry For Women
like
Find Similar
Detailed view of Santa Claus hook earrings on white card with festive pine branch - Santa Claus Ear Hook
Detail of festive snowman earrings with red hat and green scarf on wooden background - Snowman Ear Hook
Close-up of green Christmas tree earrings with colorful beads on a wooden background - Christmas Tree Ear Hook
Detailed macro of festive red Christmas bell earrings with white snowflake patterns - Bell Ear Hook
+4
Christmas Theme Dangle Earrings Resin Alloy Cartoon Santa Claus Snowman Tree Bell Cute Holiday Jewelry For Women
$0.60-0.86
No MOQ
 · 
33 sold recently
Free Shipping
Christmas Santa Claus Snowman Ginger Man Aluminum Foil And Latex Balloons For Holiday Party Home Decoration
Christmas Santa Claus Snowman Ginger Man Aluminum Foil And Latex Balloons For Holiday Party Home Decoration
like
Find Similar
Christmas balloon set with Santa Claus foil balloon and festive latex party decorations - Style 1-Santa Claus
Merry Christmas balloon set with snowman, candy cane, and festive latex balloons - Style 4-Snowman
Merry Christmas balloon set with gingerbread man, candy canes, and festive latex balloons - Style 2-Gingerbread Man
Merry Christmas balloon set with Santa Claus, candy cane and festive latex decorations - Style 3-Santa Aluminum Foil
+4
Christmas Santa Claus Snowman Ginger Man Aluminum Foil And Latex Balloons For Holiday Party Home Decoration
-12%
$2.48
No MOQ
 · 
21 views
Christmas Hair Claw Clips PVC Cartoon Santa Claus Snowman Christmas Tree Holiday Party Headwear For Women Girls
Christmas Hair Claw Clips PVC Cartoon Santa Claus Snowman Christmas Tree Holiday Party Headwear For Women Girls
like
Find Similar
Christmas Santa Claus hair claw clip made of durable PVC for festive holiday styling - Half Body Santa Style (C3-2-21)
Christmas snowman hair claw clip with red hat and scarf made of glossy acetate material - Red Scarf Snowman Style (C3-2-24)
Close-up of a festive cartoon owl hair claw clip in green, red and white colors - Green Owl Style (C3-3-26)
Close-up of a festive Santa Claus hair claw clip with a glossy finish on white background - Waving Santa Style (C3-2-26)
+4
Christmas Hair Claw Clips PVC Cartoon Santa Claus Snowman Christmas Tree Holiday Party Headwear For Women Girls
$1.07
Mix MOQ : 2
 · 
10 sold recently
Christmas Printed Imitation Linen Ribbon Snowman Red Truck Tree Hanging Ornaments For Holiday Party Gift Decoration
Christmas Printed Imitation Linen Ribbon Snowman Red Truck Tree Hanging Ornaments For Holiday Party Gift Decoration
like
Find Similar
6m Christmas ribbon with snowman print on burlap texture for tree decoration - 2m Christmas Snowman Ribbon (Width 5cm)
Red Christmas ribbon with vintage truck and tree print for festive tree decoration - 2m Christmas Red Truck Ribbon (Width 5cm)
5cm Christmas ribbon with vintage red truck and tree print on cream linen fabric - 2m Christmas Cream Truck Ribbon (Width 5cm)
6m Christmas car and tree print ribbon for festive party tree decorations - 2m Christmas Gray Truck Ribbon (Width 5cm)
+21
Christmas Printed Imitation Linen Ribbon Snowman Red Truck Tree Hanging Ornaments For Holiday Party Gift Decoration
-5%
$0.82-3.29
Mix MOQ : 2
Christmas Snowman Faux Fur Ball Keychain Cute PU Leather Plush Bag Pendant Charm Key Ring For Women Kids Xmas Gift
Christmas Snowman Faux Fur Ball Keychain Cute PU Leather Plush Bag Pendant Charm Key Ring For Women Kids Xmas Gift
like
Find Similar
Detail of plush snowman keychain with silver ring, faux fur ball and embroidery - White
Detailed view of snowman plush keychain with large yellow fur ball and silver metal clasp - Yellow
Sky blue Christmas snowman faux fur pompom keychain for handbags and car keys charm - Blue
Christmas snowman plush pompom keychain with white leather head and silver ring - Light Gray
+7
Christmas Snowman Faux Fur Ball Keychain Cute PU Leather Plush Bag Pendant Charm Key Ring For Women Kids Xmas Gift
-14%
$0.47
Mix MOQ : 2
Christmas Window Stickers PVC Static Cling Santa Claus Reindeer Snowman Snowflake Decals DIY Glass Door Party Decoration
Christmas Window Stickers PVC Static Cling Santa Claus Reindeer Snowman Snowflake Decals DIY Glass Door Party Decoration
like
Find Similar
Christmas Santa Claus and reindeer PVC static window stickers set size 50x70cm - AMJ031 Santa Claus & Reindeer
Christmas window stickers set with stars, ornaments and snowflakes in red and green colors - AMJ032 Christmas Colorful Pendants
Christmas wall decal set with Santa, reindeer and snowman in 50x70cm layout - AMJ034 Christmas Snow Scene
Detail of Christmas window stickers showing tree, snowman, and polar bear measurements - AMJ051 Whole Christmas Tree
+14
Christmas Window Stickers PVC Static Cling Santa Claus Reindeer Snowman Snowflake Decals DIY Glass Door Party Decoration
$1.15-1.30
Mix MOQ : 2
Christmas Enamel Stainless Steel Charms DIY Jewelry Making Snowman Bell Noel Cartoon Festive Accessories
Christmas Enamel Stainless Steel Charms DIY Jewelry Making Snowman Bell Noel Cartoon Festive Accessories
like
Find Similar
Christmas gift box pendant charm in gold and red enamel finish for DIY jewelry - Gold Base Red Ribbon White Polka Dot Gift Box (KLJ10390-ZLA)
Christmas gift box pendant charm in red and green enamel for DIY jewelry making - Red and Green Gold Edged Gift Box (KLJ10395-ZLA)
Blue enamel snowman snow globe charm in golden finish for DIY jewelry, 16x12mm size - Sky Blue Background Snowman Crystal Ball (KLJ10400-ZLA)
Christmas enamel candy cane charm in red and white stainless steel, 14x9mm DIY jewelry part - Red White Green Gold Candy Cane (KLJ10406-ZLA)
+14
Christmas Enamel Stainless Steel Charms DIY Jewelry Making Snowman Bell Noel Cartoon Festive Accessories
$0.58-0.68
No MOQ
Free Shipping
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access