Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Church Snow Globe Wind Lantern LED Water Filled Sparkling Sequins Vintage Bronze Plastic Holiday Decor Ornament
Christmas Church Snow Globe Wind Lantern LED Water Filled Sparkling Sequins Vintage Bronze Plastic Holiday Decor Ornament
like
Find Similar
Detail of vintage Christmas lantern with LED reindeer scene and bronze church design - Candle Church Reindeer
Christmas Church Snow Globe Wind Lantern LED Water Filled Sparkling Sequins Vintage Bronze Plastic Holiday Decor Ornament
$1.30
No MOQ
Christmas Window Clings Pink Santa Reindeer Snowflakes 3D Effect Static Adsorption PVC Reusable Festive Glass Decals Decor
Christmas Window Clings Pink Santa Reindeer Snowflakes 3D Effect Static Adsorption PVC Reusable Festive Glass Decals Decor
like
Find Similar
Pink Christmas 3D Santa and reindeer static window stickers with snowflakes - SKJD2338DS-20*30CMX9 Sheets in Bag
Christmas Window Clings Pink Santa Reindeer Snowflakes 3D Effect Static Adsorption PVC Reusable Festive Glass Decals Decor
-5%
$1.89
No MOQ
Christmas Window Stickers PVC Static Cling Reusable Santa Claus Reindeer Snowflake Shop Home Glass Decor Wall Decals
Christmas Window Stickers PVC Static Cling Reusable Santa Claus Reindeer Snowflake Shop Home Glass Decor Wall Decals
like
Find Similar
3D Christmas window stickers set featuring Santa, Reindeer and Snowman patterns - 20x30cm / 9 Sheets Set in Bag
Christmas Window Stickers PVC Static Cling Reusable Santa Claus Reindeer Snowflake Shop Home Glass Decor Wall Decals
$1.99
No MOQ
Christmas Nail Art Stickers 5D Embossed Bronzing Winter Holiday Theme Self Adhesive Decals For Manicure
Christmas Nail Art Stickers 5D Embossed Bronzing Winter Holiday Theme Self Adhesive Decals For Manicure
like
Find Similar
3D embossed Christmas nail stickers with gold accents, Christmas trees, and bears - CO-339
Christmas Nail Art Stickers 5D Embossed Bronzing Winter Holiday Theme Self Adhesive Decals For Manicure
$0.63
No MOQ
Christmas Window Stickers Static PVC Cling Decals Reusable Double Sided Color Christmas Tree Snowflakes Bow Decor
Christmas Window Stickers Static PVC Cling Decals Reusable Double Sided Color Christmas Tree Snowflakes Bow Decor
like
Find Similar
Size chart for Christmas window stickers with stars and red bows in five sizes - Small / Christmas Tree (P-SD485)
Christmas tree static window decal with red bows and stars available in five sizes - Small / Christmas Tree (P-SD486)
+8
Christmas Window Stickers Static PVC Cling Decals Reusable Double Sided Color Christmas Tree Snowflakes Bow Decor
$2.33-25.07
Mix MOQ : 2
Christmas Cake Decoration Ornaments Resin Soft Glue Toppers Tree Packaging Box Festive Dessert Baking Supplies DIY Party
Christmas Cake Decoration Ornaments Resin Soft Glue Toppers Tree Packaging Box Festive Dessert Baking Supplies DIY Party
like
Find Similar
Christmas tree shaped transparent plastic packaging box for gingerbread and cake decoration - Blister Box Christmas Tree Small 10 Sets
Set of 96 white snowflake ornaments 4cm diameter for Christmas cake decoration - Chocolate Snowflake Decorations Approx 96 Pcs
180pcs green fondant leaf cake decorations in 2cm and 3.5cm sizes for Christmas styling - Chocolate Clover Leaves Decorations 180 Pcs
Christmas Cake Decoration Ornaments Resin Soft Glue Toppers Tree Packaging Box Festive Dessert Baking Supplies DIY Party
$2.91-7.58
Mix MOQ : 3
 · 
31 views
Christmas Carousel Cake Box Paper Packaging With LED Light String Transparent Plastic Cups And Decorative Dessert Toppers
Christmas Carousel Cake Box Paper Packaging With LED Light String Transparent Plastic Cups And Decorative Dessert Toppers
like
Find Similar
Set of 50 disposable 360ml clear plastic boba cups with dome lids for Christmas desserts - 360ML Plastic Cups 50 Pcs (No Spoons)
50-piece 360ml transparent dessert cup set with spherical lids and pink spoons - 360ML Plastic Cups 50 Pcs (With Spoons)
Warm white LED copper wire string lights with 3 modes for Christmas gift box decor - Warm White 1M LED String Light (Single)
Christmas Carousel Cake Box Paper Packaging With LED Light String Transparent Plastic Cups And Decorative Dessert Toppers
$0.20-4.64
Mix MOQ : 3
Christmas Nail Stickers 5D Relief Gold Silver Bronzing Snowflake Reindeer Self Adhesive Manicure Decals Women DIY Festive Decor
Christmas Nail Stickers 5D Relief Gold Silver Bronzing Snowflake Reindeer Self Adhesive Manicure Decals Women DIY Festive Decor
like
Find Similar
Golden and silver 3D Christmas nail stickers with snowman and snowflake designs - CO-322 Gold Stamping
Christmas nail art stickers with silver snowflake and snowman motifs model Co-322 - CO-322 Silver Stamping
Detail of Christmas nail stickers with gold embossed snowflakes, reindeer, and trees - CO-323 Gold Stamping
Detailed relief of Christmas nail stickers with snowflakes and reindeer on gray nails - CO-323 Silver Stamping
Christmas Nail Stickers 5D Relief Gold Silver Bronzing Snowflake Reindeer Self Adhesive Manicure Decals Women DIY Festive Decor
$0.78
No MOQ
Christmas Tree Star Embroidery Pillow Covers Plush Soft Cushion Case For Living Room Sofa Holiday Party Decor
Christmas Tree Star Embroidery Pillow Covers Plush Soft Cushion Case For Living Room Sofa Holiday Party Decor
like
Find Similar
White Christmas pillow covers with embroidered gold stars and plush tree texture - Milky White / 30x50cm (Cover Only)
Pair of red plush Christmas pillow covers with embossed tree patterns and gold stars - Red / 30x50cm (Cover Only)
Dark green Christmas pillow covers with embroidered yellow stars and tree textures - Christmas Green / 30x50cm (Cover Only)
+6
Christmas Tree Star Embroidery Pillow Covers Plush Soft Cushion Case For Living Room Sofa Holiday Party Decor
-4%
$5.07-6.30
Mix MOQ : 2
Christmas Nail Art Stickers Embossed Gold Metallic Snowflake Tree Design Self Adhesive Manicure Decals For Women
Christmas Nail Art Stickers Embossed Gold Metallic Snowflake Tree Design Self Adhesive Manicure Decals For Women
like
Find Similar
Christmas nail stickers M-235 with golden snowflakes, snowmen and stars designs - M-235
Christmas Nail Art Stickers Embossed Gold Metallic Snowflake Tree Design Self Adhesive Manicure Decals For Women
-9%
$1.17
No MOQ
Free Shipping
Christmas Nail Art Stickers 3D Embossed Self Adhesive Decals Santa Claus Snowflakes Gingerbread Man Festive Decoration
Christmas Nail Art Stickers 3D Embossed Self Adhesive Decals Santa Claus Snowflakes Gingerbread Man Festive Decoration
like
Find Similar
Christmas nail art stickers featuring Santa, snowflakes, and reindeer designs M-777 - M-777 Christmas Series
Christmas Nail Art Stickers 3D Embossed Self Adhesive Decals Santa Claus Snowflakes Gingerbread Man Festive Decoration
$1.30
No MOQ
Free Shipping
Christmas 3D Relief Press On Nails Handmade Resin Short Ladder Shape Festive Holiday Manicure
Christmas 3D Relief Press On Nails Handmade Resin Short Ladder Shape Festive Holiday Manicure
like
Find Similar
3D Christmas handmade press-on nails set with Santa and reindeer relief designs - Extra Small (XS)
Christmas 3D Relief Press On Nails Handmade Resin Short Ladder Shape Festive Holiday Manicure
$6.34
No MOQ
Free Shipping
Christmas Press On Nails 3D Embossed Handmade Reusable Short Round Fake Nails Winter Holiday Nail Art For Women
Christmas Press On Nails 3D Embossed Handmade Reusable Short Round Fake Nails Winter Holiday Nail Art For Women
like
Find Similar
Handmade 3D relief Christmas press-on nails featuring snowman and tree on canvas board - Extra Small (XS) / 2227 Short Round (Christmas Theme)
Christmas Press On Nails 3D Embossed Handmade Reusable Short Round Fake Nails Winter Holiday Nail Art For Women
$4.03
No MOQ
Free Shipping
Handmade Christmas 3D Relief Press On Nails Short Round UV Gel Reusable Artificial Nails For Women Festive Holiday
Handmade Christmas 3D Relief Press On Nails Short Round UV Gel Reusable Artificial Nails For Women Festive Holiday
like
Find Similar
Handmade 3D relief Christmas press-on nails featuring snowman and tree on canvas board - Extra Small (XS)
Handmade Christmas 3D Relief Press On Nails Short Round UV Gel Reusable Artificial Nails For Women Festive Holiday
-4%
$3.83
No MOQ
Free Shipping
Christmas Window Static Stickers PVC Cartoon Santa Claus Snowflake Reindeer Glass Decals For Holiday Party Decor
Christmas Window Static Stickers PVC Cartoon Santa Claus Snowflake Reindeer Glass Decals For Holiday Party Decor
like
Find Similar
Christmas static window stickers with Santa and Snowman theme in various sizing options - Small
+4
Christmas Window Static Stickers PVC Cartoon Santa Claus Snowflake Reindeer Glass Decals For Holiday Party Decor
$1.82-20.75
Mix MOQ : 2
Christmas Stickers Holiday Decoration Labels Kraft Paper Gold Stamping Cartoon Patterns For Gift Wrapping DIY Scrapbooking Festive Ornaments
Christmas Stickers Holiday Decoration Labels Kraft Paper Gold Stamping Cartoon Patterns For Gift Wrapping DIY Scrapbooking Festive Ornaments
like
Find Similar
Christmas theme sticker set style A featuring snowman and tree patterns 12 pieces - 12 Sheets / Style A (Cartoon)
Festive red and green Merry Christmas sticker set with gold foil for holiday packaging - 12 Sheets / Red and Green (Gold Stamped)
Christmas Stickers Holiday Decoration Labels Kraft Paper Gold Stamping Cartoon Patterns For Gift Wrapping DIY Scrapbooking Festive Ornaments
$0.81
Mix MOQ : 2
Christmas Snow Globe LED Light Up Water Globe Resin Glass Desktop Decorative Ornament Festive Cartoon Character Gift
Christmas Snow Globe LED Light Up Water Globe Resin Glass Desktop Decorative Ornament Festive Cartoon Character Gift
like
Find Similar
Set of four red Christmas crystal balls with Santa, Snowman, and Reindeer figurines - Small (4.5x4.5x6.8cm) / Christmas #23 (Snowman)
Cartoon Christmas snow globe set with Santa figurines and glowing festive light base - Small (4.5x4.5x6.8cm) / Christmas #21 (Santa)
Luminous Christmas crystal balls with Santa and Snowman in a festive snow scene - Small (4.5x4.5x6.8cm) / Christmas #22 (Reindeer)
Christmas snow globes featuring Santa, Snowman, and Reindeer with red Merry Christmas bases - Small (4.5x4.5x6.8cm) / Christmas #24 (Party)
+13
Christmas Snow Globe LED Light Up Water Globe Resin Glass Desktop Decorative Ornament Festive Cartoon Character Gift
$1.90-4.92
Mix MOQ : 2
 · 
40 views
Press On Nails Christmas Santa And Tree Pattern Short Trapezoid New Year Theme Glossy Resin Festive Cute Handmade Style
Press On Nails Christmas Santa And Tree Pattern Short Trapezoid New Year Theme Glossy Resin Festive Cute Handmade Style
like
Find Similar
Cute Christmas Santa Claus press-on nails with red and green festive hand-painted designs - Extra Small (XS)
Press On Nails Christmas Santa And Tree Pattern Short Trapezoid New Year Theme Glossy Resin Festive Cute Handmade Style
$4.99
No MOQ
Free Shipping
Christmas Tablecloth Polyester Printed Reindeer Santa Claus Tree Holiday Party Decor Rectangular Dustproof Dinner Table Cover
Christmas Tablecloth Polyester Printed Reindeer Santa Claus Tree Holiday Party Decor Rectangular Dustproof Dinner Table Cover
like
Find Similar
Detailed Christmas tablecloth pattern with green background featuring Merry Christmas motifs - 140*260cm / Dark Green (Christmas Cake)
Christmas tablecloth set with red snowman patterns and matching festive chair covers - 140*260cm / Red (Christmas Snowman)
Festive Christmas tablecloth featuring red and green holiday prints on white fabric base - 140*260cm / White (Christmas Bell House)
Detailed view of red plaid Christmas tablecloth with holly leaves and gingerbread house - 140*260cm / Red Checkered (Christmas Large Grid)
+61
Christmas Tablecloth Polyester Printed Reindeer Santa Claus Tree Holiday Party Decor Rectangular Dustproof Dinner Table Cover
$4.29-10.63
No MOQ
Christmas Stickers PVC Waterproof Romantic Retro Victorian Illustration Festive Decoration For Phone Case Water Bottle Scrapbooking
Christmas Stickers PVC Waterproof Romantic Retro Victorian Illustration Festive Decoration For Phone Case Water Bottle Scrapbooking
like
Find Similar
Set of 50 vintage Christmas stickers featuring Santa, reindeer, and festive retro designs - 50 Sheets/Pack
Christmas Stickers PVC Waterproof Romantic Retro Victorian Illustration Festive Decoration For Phone Case Water Bottle Scrapbooking
$0.95
No MOQ
Christmas Plush Pillows Soft Sherpa Fleece Santa Claus Reindeer Tree Holiday Home Decor Accents Kids Gift Novelty
Christmas Plush Pillows Soft Sherpa Fleece Santa Claus Reindeer Tree Holiday Home Decor Accents Kids Gift Novelty
like
Find Similar
Soft Santa Claus plush pillow in classic red and white Christmas festive home decor 40cm - Red Santa Claus / 40CM
Christmas snowman-shaped white plush rabbit pillow with red green plaid scarf, 45cm size - White Snow Rabbit / 45cm
Green lamb wool Christmas tree plush pillow with gold star and embroidery decor, 45cm size - Green Christmas Tree / 45cm
Brown reindeer plush Christmas pillow with gold ribbon bow and cute facial embroidery - Brown Reindeer / 45cm
Christmas Plush Pillows Soft Sherpa Fleece Santa Claus Reindeer Tree Holiday Home Decor Accents Kids Gift Novelty
$4.58-4.90
No MOQ
3D Embossed Christmas Nail Art Stickers Self Adhesive Santa Reindeer Snowflakes Bronzing Gingerbread Man DIY Manicure Decor
3D Embossed Christmas Nail Art Stickers Self Adhesive Santa Reindeer Snowflakes Bronzing Gingerbread Man DIY Manicure Decor
like
Find Similar
3D embossed Christmas nail stickers featuring Santa, reindeer, and snowflakes in silver finish - M-741 Silver Gilding + Jelly Glue
3D relief Christmas nail stickers M-759 with Santa and gingerbread man in gold foil - M-759 Silver Gilding Jelly Glue
Self-adhesive silver foil Christmas nail art stickers with Santa and snowflake designs - M-763 Colorful Gold Gilding
3D Embossed Christmas Nail Art Stickers Self Adhesive Santa Reindeer Snowflakes Bronzing Gingerbread Man DIY Manicure Decor
-9%
$1.17
No MOQ
Free Shipping
Christmas Wreath Artificial Pine Needles With Pine Cones Dried Orange Metal Bell Handcrafted Wall Door Hanging Ornament
Christmas Wreath Artificial Pine Needles With Pine Cones Dried Orange Metal Bell Handcrafted Wall Door Hanging Ornament
like
Find Similar
Christmas wreath with felt snowman and reindeer ornaments on green pine needles - Artificial Pine Wreath Style A 17cm / 17cm
Miniature Christmas wreath with red bow, Santa felt ornament and jingle bell - Artificial Pine Wreath Style B 20cm / 20cm
Christmas wreath with pine cones, dried orange slices and a red bell for door decoration - Artificial Pine Wreath Style C 35cm (Natural Elements) / 35cm
Christmas wreath hanging with pine needles, plush Santa, reindeer and green metal bell - Artificial Pine Wreath Style D 35cm (Plush Dolls) / 35cm
Christmas Wreath Artificial Pine Needles With Pine Cones Dried Orange Metal Bell Handcrafted Wall Door Hanging Ornament
$8.90-10.35
No MOQ
Free Shipping
Christmas Wreath Artificial Greenery With Red Berries Pine Cones Bows Balls Poinsettia Merry Christmas Sign Decor
Christmas Wreath Artificial Greenery With Red Berries Pine Cones Bows Balls Poinsettia Merry Christmas Sign Decor
like
Find Similar
Christmas wreath with red berries, pine cones and Merry Christmas sign on white background - Plaid Bowknot Christmas Ball Flocked Wreath
Christmas wreath with flocked green pine, colorful baubles and Merry Christmas sign 40cm - Round Wood Slices Christmas Ball Flocked Wreath
Christmas wreath with red berries, ribbons and Merry Christmas sign, 15.74 inch diameter - Ribbon Painted Christmas Ball Wreath
40cm Christmas wreath with purple ornaments and Merry Christmas sign on white background - Purple Christmas Ball Flocked Wreath
+5
Christmas Wreath Artificial Greenery With Red Berries Pine Cones Bows Balls Poinsettia Merry Christmas Sign Decor
$9.51-14.12
No MOQ
Christmas Tablecloth Rectangular Polyester Fabric Reindeer Santa Snowflake Print Festive Dining Table Decoration American Style
Christmas Tablecloth Rectangular Polyester Fabric Reindeer Santa Snowflake Print Festive Dining Table Decoration American Style
like
Find Similar
Green Christmas tablecloth with Merry Christmas text and holiday patterns on a festive table - 140*100cm / Green Elk
Close-up of green rectangular Christmas tablecloth with festive trees and stars on a wood table - 140*100cm / Green Christmas
Blue Christmas tablecloth featuring Santa's sleigh and reindeer in festive home setting - 140*100cm / Blue Christmas
Close-up of Christmas tablecloth showing knitted texture, pine trees and holiday patterns - 140*100cm / Christmas Tree
+52
Christmas Tablecloth Rectangular Polyester Fabric Reindeer Santa Snowflake Print Festive Dining Table Decoration American Style
-4%
$4.08-10.11
No MOQ
Christmas Cushion Cover Linen Square Decorative Pillowcase For Sofa Couch Santa Reindeer Tree Printed Holiday Home Decor
Christmas Cushion Cover Linen Square Decorative Pillowcase For Sofa Couch Santa Reindeer Tree Printed Holiday Home Decor
like
Find Similar
Linen Christmas pillowcase with Merry Christmas text and hot cocoa mug illustration - Merry Christmas Hot Cocoa
Christmas tree and cocoa cup print linen pillowcase with Current Mood slogan - Current Mood Christmas Tree
Linen Christmas pillowcase featuring red HO HO HO text with reindeer and tree motifs - HO HO HO Lettering
Linen Christmas pillowcase featuring red Joy text with Santa hat and gift bag design - Joy Lettering
+11
Christmas Cushion Cover Linen Square Decorative Pillowcase For Sofa Couch Santa Reindeer Tree Printed Holiday Home Decor
$1.30
Mix MOQ : 2
Christmas Socks Cotton Embroidery Warm Winter Mid Calf Festive Pattern For Women
Christmas Socks Cotton Embroidery Warm Winter Mid Calf Festive Pattern For Women
like
Find Similar
Red Christmas crew socks with knit texture and embroidered tree on white background - One Size / Christmas Red
Dark green knitted crew socks with cute snowman embroidery for festive Christmas style - One Size / Christmas Green
Beige cable knit Christmas socks featuring a festive snowman embroidery on the cuff - One Size / Beige
Dark grey crew socks with snowman embroidery and festive Christmas twist pattern - One Size / Dark Gray
+3
Christmas Socks Cotton Embroidery Warm Winter Mid Calf Festive Pattern For Women
$1.41
Mix MOQ : 10
Christmas Wreath Window Sticker Static Cling PVC Glass Decal Merry Christmas Theme For Holiday Home Shop Decoration
Christmas Wreath Window Sticker Static Cling PVC Glass Decal Merry Christmas Theme For Holiday Home Shop Decoration
like
Find Similar
Christmas wreath static window sticker 38x38cm with snowman and bell for festive decor - Christmas Wreath
Christmas Wreath Window Sticker Static Cling PVC Glass Decal Merry Christmas Theme For Holiday Home Shop Decoration
$1.01
No MOQ
Christmas Window Stickers PVC Static Cling Reindeer Snowflake 2026 New Year Decoration For Glass Mall Shop Home
Christmas Window Stickers PVC Static Cling Reindeer Snowflake 2026 New Year Decoration For Glass Mall Shop Home
like
Find Similar
2026 Christmas reindeer wall sticker with snowflakes and stars, dimensions 105x45cm - Color 2026 Reindeer
2026 Christmas static window stickers set with Santa, reindeer and snowman decals - Color 2026 Santa Claus
Christmas 2021 window stickers with Santa and reindeer motifs in 20x30cm layout - White 2026 Year
Christmas 2027 reindeer and snowflake static window cling stickers for holiday decoration - Color Christmas New Year 2026
Christmas Window Stickers PVC Static Cling Reindeer Snowflake 2026 New Year Decoration For Glass Mall Shop Home
$1.04-1.30
Mix MOQ : 2
Christmas Tree Snow Globe LED Glowing Water Ball Desktop Ornament Retro Gold Base Resin Glass Decorative Festive Night Light
Christmas Tree Snow Globe LED Glowing Water Ball Desktop Ornament Retro Gold Base Resin Glass Decorative Festive Night Light
like
Find Similar
Christmas tree snow globe with Santa in a red car and golden embossed base stand - Green Tree Santa in Car
Vintage white Christmas tree snow globe lamp with red truck and sparkling glitter inside - White Tree Truck with Tree
Luminous Christmas tree snow globe with Santa figure and golden base night light - Red Tree Santa with Backpack
Luminous Christmas tree crystal ball with Santa Claus and golden embossed base - Green Tree Sitting Santa
Christmas Tree Snow Globe LED Glowing Water Ball Desktop Ornament Retro Gold Base Resin Glass Decorative Festive Night Light
-4%
$4.25
Mix MOQ : 2
Christmas Cushion Covers Short Plush Elegant Artistic Santa Reindeer Illustration Cases For Sofa Living Room Home Decor
Christmas Cushion Covers Short Plush Elegant Artistic Santa Reindeer Illustration Cases For Sofa Living Room Home Decor
like
Find Similar
Luxury Christmas pillowcase with golden pine cones and succulents in soft blue finish - TQDS68-1(Golden Pinecones & Light Blue Plants)
Blue Christmas pillow cover with gold Santa print on white fabric with pine cones - TQDS68-2(Blue Background Gold Print)
Ice blue floral Christmas pillow cover with elegant white pearls and gold accents - TQDS68-3(Ice Blue Floral with Pearl)
Elegant blue and gold Christmas throw pillow cover with festive holiday gift illustration - TQDS68-4(Festive Gift Box)
+39
Christmas Cushion Covers Short Plush Elegant Artistic Santa Reindeer Illustration Cases For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Vintage Christmas Decorative Pillow Case Linen Blend Square Cushion Cover For Sofa Living Room Home Decor Retro Santa
Vintage Christmas Decorative Pillow Case Linen Blend Square Cushion Cover For Sofa Living Room Home Decor Retro Santa
like
Find Similar
Christmas pillowcase with vintage Santa Claus print in cotton linen for festive home decor - YMD511-20 (Vintage Santa)
Christmas cushion cover featuring a vintage stag and pink roses on textured linen fabric - YMD511-21 (Vintage Buck & Flowers)
Vintage Christmas throw pillow case with retro teddy bear and festive tree design - YMD511-22 (Teddy Bear & Xmas Tree)
Vintage Christmas pillowcase with holly berries and retro candle on old manuscript pattern - YMD511-23 (Candlestick & Holly)
+24
Vintage Christmas Decorative Pillow Case Linen Blend Square Cushion Cover For Sofa Living Room Home Decor Retro Santa
$1.14
Mix MOQ : 2
 · 
14 sold recently
Christmas DIY Scene Stickers Waterproof PVC Cartoon Santa Claus Reindeer Puzzle Decals For Holiday Party Decor Kids Gift
Christmas DIY Scene Stickers Waterproof PVC Cartoon Santa Claus Reindeer Puzzle Decals For Holiday Party Decor Kids Gift
like
Find Similar
Christmas DIY stickers set with Santa and reindeer scenery cards for holiday fun - Christmas Theme (8 Sheets/Bag)
Christmas DIY Scene Stickers Waterproof PVC Cartoon Santa Claus Reindeer Puzzle Decals For Holiday Party Decor Kids Gift
$0.95
No MOQ
Christmas Tree Topper Star Plastic LED Light Up Colorful Pentagram Ornament Holiday Party Decoration Tree Top Glow
Christmas Tree Topper Star Plastic LED Light Up Colorful Pentagram Ornament Holiday Party Decoration Tree Top Glow
like
Find Similar
Colorful 14cm LED star tree topper with transparent faceted design and 39g weight - Crystal - Small with Light
18cm colorful LED Christmas tree top star with 7.09 inch frame and glowing lights - Crystal - Medium with Light
18cm 7.09 inch LED Christmas tree topper star with purple crystal glowing lights - Crystal - Christmas Tree with Light
Christmas Tree Topper Star Plastic LED Light Up Colorful Pentagram Ornament Holiday Party Decoration Tree Top Glow
-5%
$1.59-1.86
Mix MOQ : 2
Christmas Dangle Rings Alloy Drip Oil Reindeer Candy Cane Bell Santa Claus Holiday Party Jewelry For Women
Christmas Dangle Rings Alloy Drip Oil Reindeer Candy Cane Bell Santa Claus Holiday Party Jewelry For Women
like
Find Similar
Christmas rings set featuring Santa Claus elk and bell pendants on golden open bands - 4-Piece Set (Santa/Bell/Star/Tassel) / Gold
Three-piece Christmas ring set with reindeer, candy cane, and snowman charms in gold finish - 3-Piece Set (Reindeer/Cane/Snowman) / Gold
Christmas Dangle Rings Alloy Drip Oil Reindeer Candy Cane Bell Santa Claus Holiday Party Jewelry For Women
$1.26-1.41
Mix MOQ : 2
Free Shipping
Christmas Wooden House Ornaments LED Light Up Hanging Tree Decoration Wood Small Cabin Warm Glow Novelty
Christmas Wooden House Ornaments LED Light Up Hanging Tree Decoration Wood Small Cabin Warm Glow Novelty
like
Find Similar
Hanging wooden Christmas ornament with LED light, rustic cabin style and red berry decor - Wood Cabin Type A
Wooden Christmas house ornament with warm LED light and hemp rope for tree decoration - Wood Cabin Type B
Hanging wooden Christmas cabin with warm LED light and decorative snowflake cutouts - Wood Cabin Type C
LED light-up wooden Christmas cabin ornament with reindeer carvings and jute rope hanging - Wood Cabin Type E (Reindeer & Santa)
+4
Christmas Wooden House Ornaments LED Light Up Hanging Tree Decoration Wood Small Cabin Warm Glow Novelty
$1.79-2.54
No MOQ
Christmas House Ornament Acrylic Snow Cloud Pendant Xmas Tree Decoration Car Interior Rearview Mirror Retro Style
Christmas House Ornament Acrylic Snow Cloud Pendant Xmas Tree Decoration Car Interior Rearview Mirror Retro Style
like
Find Similar
Size chart for acrylic Christmas snow house ornament showing dimensions 8x7x0.3 cm - Style A
Detailed size chart for Christmas house acrylic ornament showing 8x7cm dimensions - Style B
Detailed view of Christmas snow house acrylic ornament with dimensions and thickness - Style C
Detailed view of Christmas cloud house acrylic pendant showing 8cm width and 0.3cm thickness - Style D
+2
Christmas House Ornament Acrylic Snow Cloud Pendant Xmas Tree Decoration Car Interior Rearview Mirror Retro Style
-4%
$0.23-1.15
Mix MOQ : 2
Christmas Tablecloth Polyester Rectangular Holiday Party Decor Festive Dinner Table Cover Digital Printed Pattern
Christmas Tablecloth Polyester Rectangular Holiday Party Decor Festive Dinner Table Cover Digital Printed Pattern
like
Find Similar
Red Christmas tablecloth with pine cones and Merry Christmas lettering for festive party decor - 100*150cm / TQZB02-1 Red Christmas
Rectangular Christmas tablecloth with festive patchwork pattern featuring Santa and trees - 100*150cm / TQZB02-2 Patchwork Style
Green rectangular Christmas tablecloth featuring Merry Christmas text and festive holiday icons - 100*150cm / TQZB02-3 Green Christmas
Festive red and white Christmas tablecloth with pinecones and Merry Christmas message - 100*150cm / TQZB02-4 Red Decoration
+50
Christmas Tablecloth Polyester Rectangular Holiday Party Decor Festive Dinner Table Cover Digital Printed Pattern
$5.45-8.62
Mix MOQ : 2
 · 
18 views
Handmade Wool Felt Christmas Ornaments Hanging Decorations Bear Star Glove Stocking Tree Shape Festive Holiday Home Decor
Handmade Wool Felt Christmas Ornaments Hanging Decorations Bear Star Glove Stocking Tree Shape Festive Holiday Home Decor
like
Find Similar
Set of three white wool felt bear ornaments with red hats for Christmas tree decoration - Wool Felt (White Bear)
Three-pack red wool felt Christmas glove ornaments featuring snowmen and white sequins - Wool Felt (Red Glove)
Three red wool felt star Christmas tree ornaments with gold bells and sequins - Wool Felt (Red Five-Pointed Star)
Set of 3 mini red and blue felt Christmas stocking ornaments for holiday tree decoration - Wool Felt (Blue Red Sock)
+14
Handmade Wool Felt Christmas Ornaments Hanging Decorations Bear Star Glove Stocking Tree Shape Festive Holiday Home Decor
$2.02-3.60
No MOQ
Free Shipping
Christmas Charm Bangle Adjustable Alloy Bracelet Enamel Reindeer Santa Snowflake Festive Holiday Jewelry For Women
Christmas Charm Bangle Adjustable Alloy Bracelet Enamel Reindeer Santa Snowflake Festive Holiday Jewelry For Women
like
Find Similar
Close-up of golden adjustable Christmas bracelet with reindeer pendant and festive beads - Reindeer (D1352)
Detail of adjustable Christmas bracelet with snowflake charm and pine cone background - Snowflake Round Tag (D1353)
Detail of adjustable gold Christmas bracelet with red snowflake glove and festive beads - Red Glove (D1354)
Detail of adjustable gold Christmas bracelet with green snowflake charms and festive decor - Green Snowflake (D1355)
+18
Christmas Charm Bangle Adjustable Alloy Bracelet Enamel Reindeer Santa Snowflake Festive Holiday Jewelry For Women
$0.52
No MOQ
Free Shipping
Stair Treads Mats Non-Slip Self-Adhesive Washable Polyester Step Rugs For Wooden Stairs Home Protection
Stair Treads Mats Non-Slip Self-Adhesive Washable Polyester Step Rugs For Wooden Stairs Home Protection
like
Find Similar
Detail of vintage Persian style non-slip stair treads in four different ethnic patterns - Retro Ethnic Style (BD202405014)
Detail showing four vintage Persian style non-slip stair treads in various floral patterns - Retro Persian Print (BD202405016A)
Detail view of anti-slip stair tread mats in various vintage Persian patterns and colors - Ethnic Center Pattern Style (BD202405017)
Close-up of Persian style non-slip stair treads showing six vintage color patterns - Persian Medallion Style (BD202405017A)
+14
Stair Treads Mats Non-Slip Self-Adhesive Washable Polyester Step Rugs For Wooden Stairs Home Protection
$1.99
Mix MOQ : 2
Resin Christmas DIY Charms Flatback Cabochons For Phone Case Hair Clip Scrapbooking Santa Reindeer Tree Ornament
Resin Christmas DIY Charms Flatback Cabochons For Phone Case Hair Clip Scrapbooking Santa Reindeer Tree Ornament
like
Find Similar
DIY Christmas Santa resin charm for hair clips and shoes, size 26mm by 24mm - Santa Claus
Cartoon resin bear DIY charm with red scarf and flower for craft, 25mm x 23mm size - Bear with Scarf
Red Christmas glove resin charms with stars and smileys for DIY crafts and shoe decor - Gloves
Christmas resin DIY accessory featuring a red and white snow house for hair clips - House
+6
Resin Christmas DIY Charms Flatback Cabochons For Phone Case Hair Clip Scrapbooking Santa Reindeer Tree Ornament
$0.10
No MOQ
 · 
120 sold recently
Handmade Wool Felt Christmas Tree Ornaments Gingerbread Man Candy Cane Socks Reindeer Holiday Hanging DIY Decor Pendants
Handmade Wool Felt Christmas Tree Ornaments Gingerbread Man Candy Cane Socks Reindeer Holiday Hanging DIY Decor Pendants
like
Find Similar
Set of 3 wool felt candy cane Christmas ornaments with red and white stripes - Wool Felt (Large White Candy Cane)
Set of 3 handmade wool felt Christmas candy canes decorations in white and red spiral design - Wool Felt (Small White Candy Cane)
Set of 3 wool felt Christmas candy cane ornaments with red and white spiral stripes - Wool Felt (Small Red Candy Cane)
Set of three red wool felt Christmas gift box ornaments with white polka dots - Wool Felt (Red Polka Dot Gift Box)
+13
Handmade Wool Felt Christmas Tree Ornaments Gingerbread Man Candy Cane Socks Reindeer Holiday Hanging DIY Decor Pendants
$2.02-3.60
No MOQ
Free Shipping
Christmas Stickers PVC Waterproof 3D Visual Effect Cartoon Santa Reindeer Animals Laptop Phone Case DIY Decoration
Christmas Stickers PVC Waterproof 3D Visual Effect Cartoon Santa Reindeer Animals Laptop Phone Case DIY Decoration
like
Find Similar
1 option
Christmas Stickers PVC Waterproof 3D Visual Effect Cartoon Santa Reindeer Animals Laptop Phone Case DIY Decoration
$0.95
No MOQ
Christmas Door Mat Reclon Fiber Non-Slip Absorbent Floor Rug For Entrance Kitchen Living Room Festive Decor
Christmas Door Mat Reclon Fiber Non-Slip Absorbent Floor Rug For Entrance Kitchen Living Room Festive Decor
like
Find Similar
Red Christmas doormat with festive ornaments and brown border on wooden floor - 40*60cm / Red Christmas Gift Box(CHDT-2024-01239)
Blue Christmas welcome mat with festive tree and stocking pattern for indoor entry - 40*60cm / Deep Blue Christmas Tree(CHDT-2024-01240)
Rectangular beige Christmas door mat featuring Santa, snowman and gingerbread man - 40*60cm / Beige Santa Claus(CHDT-2024-01241)
Pink Christmas welcome mat with festive tree and gift box pattern on wooden floor - 40*60cm / Pink Christmas Story(CHDT-2024-01242)
+14
Christmas Door Mat Reclon Fiber Non-Slip Absorbent Floor Rug For Entrance Kitchen Living Room Festive Decor
$2.39-5.32
Mix MOQ : 10
Christmas Necklace Double Layer Beaded Seed Beads Santa Claus Reindeer Snowflake Alloy Pendant Holiday Festive Accessory
Christmas Necklace Double Layer Beaded Seed Beads Santa Claus Reindeer Snowflake Alloy Pendant Holiday Festive Accessory
like
Find Similar
Close-up of double-layer Christmas necklace with red green beads and snowflake pendant - D1226 Double Layer Snowflake Pendant
Detail view of double-layer Christmas choker with red white green beads and a sock pendant - D1227 Double Layer Christmas Stocking Pendant
Detail of Christmas beaded necklace featuring Santa Claus pendant and festive colors - D1228 Double Layer Santa Claus Pendant
Close-up of a double-layered Christmas beaded necklace and Santa pendant on a model - D1229 Double Layer Merry Christmas Tag
+20
Christmas Necklace Double Layer Beaded Seed Beads Santa Claus Reindeer Snowflake Alloy Pendant Holiday Festive Accessory
-4%
$0.60-0.65
Mix MOQ : 2
Christmas Earring Studs Alloy Resin 925 Sterling Silver Earring Post Santa Tree Reindeer Snowflake Holiday Jewelry Women
Christmas Earring Studs Alloy Resin 925 Sterling Silver Earring Post Santa Tree Reindeer Snowflake Holiday Jewelry Women
like
Find Similar
6-pair Christmas stud earrings set featuring reindeer and snowflake polymer clay designs - Style B (6 Pairs)
Christmas 6-pair stud earring set with festive pine tree, snowman and snowflake designs - Style A (6 Pairs)
6-pair Christmas stud earring set featuring red and green resin holiday icons - Style C (6 Pairs)
6-pair Christmas stud earring set featuring elk, bear and candy cane on white card - Style D (14 Pairs)
+2
Christmas Earring Studs Alloy Resin 925 Sterling Silver Earring Post Santa Tree Reindeer Snowflake Holiday Jewelry Women
$4.06
No MOQ
 · 
13 views
Free Shipping
Christmas Wall Stickers PVC Waterproof Cartoon Santa Claus Reindeer Tree Decals For Home Holiday Window Decor
Christmas Wall Stickers PVC Waterproof Cartoon Santa Claus Reindeer Tree Decals For Home Holiday Window Decor
like
Find Similar
Detailed size chart for Christmas wall stickers with Santa, reindeer and tree patterns - 30*90CM x 2 Sheets
Christmas Wall Stickers PVC Waterproof Cartoon Santa Claus Reindeer Tree Decals For Home Holiday Window Decor
-4%
$1.78
No MOQ
Christmas Beaded Bracelets Polymer Clay Alloy Santa Charms Elastic Holiday Party Jewelry Gift For Women Men
Christmas Beaded Bracelets Polymer Clay Alloy Santa Charms Elastic Holiday Party Jewelry Gift For Women Men
like
Find Similar
Detail of Christmas beaded bracelet set with Santa pendants and festive happy charms - Clay Mix-Santa-Snowflake-Letters
Christmas beaded bracelet set with Santa Claus charm and festive red green beads - 4 Layers-Christmas Tree-Red Green White
5-piece Christmas beaded bracelet set with Merry Xmas lettering and Santa charm - 5 Piece Set-Santa-Merry Xmas
Christmas beaded bracelet set with Santa motifs and green snowflake charm on card - 6 Layers-Green Snowflake-Enamel
+6
Christmas Beaded Bracelets Polymer Clay Alloy Santa Charms Elastic Holiday Party Jewelry Gift For Women Men
-5%
$0.92-1.32
No MOQ
 · 
12 views
Christmas Santa Claus Toilet Lid Stickers Waterproof PVC Removable Bathroom Wall Decals Holiday Home Decorations Cartoon
Christmas Santa Claus Toilet Lid Stickers Waterproof PVC Removable Bathroom Wall Decals Holiday Home Decorations Cartoon
like
Find Similar
Christmas toilet lid sticker featuring Santa Claus with gifts, size 27.5 x 26 cm - Style 01 (Santa with Gifts)
Christmas toilet lid sticker featuring sleeping Santa Claus, 27.5cm by 25.5cm decor - Style 02 (Santa on Branch)
Christmas Santa Claus sitting on chair removable toilet lid sticker decal 27.5x27cm - Style 03 (Santa on Rocking Chair)
Christmas Santa Claus Toilet Lid Stickers Waterproof PVC Removable Bathroom Wall Decals Holiday Home Decorations Cartoon
$0.92
No MOQ
Christmas Window Sticker PVC Static Cling Reusable No Glue Glass Door Storefront Home Gold Tree Snowflake Holiday Decor
Christmas Window Sticker PVC Static Cling Reusable No Glue Glass Door Storefront Home Gold Tree Snowflake Holiday Decor
like
Find Similar
Christmas tree window sticker with red and gold ornaments in five sizes for glass decor - Chandelier Christmas Tree / Small
Golden Christmas tree electrostatic window sticker with stars and snowflake patterns - Gold Minimalist Christmas / Small
Christmas tree window sticker with snowman and gingerbread man in static PVC material - Letter Xmas Tree / Small
Christmas penguin static window cling with Merry Christmas sign for holiday decoration - Penguin Signage / Small
+71
Christmas Window Sticker PVC Static Cling Reusable No Glue Glass Door Storefront Home Gold Tree Snowflake Holiday Decor
$0.75-13.08
No MOQ
Christmas Window Stickers PVC Static Reusable Glass Door Decals Xmas Tree Reindeer Santa Holiday Party Home Decor
Christmas Window Stickers PVC Static Reusable Glass Door Decals Xmas Tree Reindeer Santa Holiday Party Home Decor
like
Find Similar
Christmas tree window sticker with red and gold ornaments in five sizes for glass decor - DY-UV303 Chandelier Xmas Tree / XX-Large
Golden Christmas tree electrostatic window sticker with stars and snowflake patterns - DY-UV304 Gold Minimalist Christmas / XX-Large
Christmas tree window sticker with snowman and gingerbread man in static PVC material - DY-UV305 Alphabet Xmas Tree / XX-Large
Christmas train static window decals in five sizes for festive holiday decoration - DY-UV308 Christmas Train / XX-Large
+71
Christmas Window Stickers PVC Static Reusable Glass Door Decals Xmas Tree Reindeer Santa Holiday Party Home Decor
$0.75-13.08
No MOQ
Free Shipping
Christmas Charm Bracelet Alloy Enamel Santa Reindeer Tree Charms Imitation Artificial Pearls Crystal Beads Women Holiday Party Gift
Christmas Charm Bracelet Alloy Enamel Santa Reindeer Tree Charms Imitation Artificial Pearls Crystal Beads Women Holiday Party Gift
like
Find Similar
Gold Christmas charm bracelet with Santa, reindeer, and pearl beads on a toggle clasp chain - Santa/Tree/Snowflake/Red Hat/Sock / Gold
Christmas charm bracelet with Santa, tree and reindeer pendants on golden OT chain - Santa/Tree/Snowflake/Wreath/Gloves / Gold
Silver Christmas charm bracelet with Santa, tree and reindeer icons, OT toggle clasp - Santa/Tree/Snowflake/Snowman/Wreath / Silver
Christmas charm bracelet with Santa Claus and reindeer pendants on silver chain - Santa/Snowman/Snowflake/Gift Bag/Gloves / Silver
Christmas Charm Bracelet Alloy Enamel Santa Reindeer Tree Charms Imitation Artificial Pearls Crystal Beads Women Holiday Party Gift
$1.55
No MOQ
Free Shipping
Christmas Tree Ornaments Balls Shatterproof Plastic Mixed Shapes Hanging Decorations Festive Holiday Home Party Decor
Christmas Tree Ornaments Balls Shatterproof Plastic Mixed Shapes Hanging Decorations Festive Holiday Home Party Decor
like
Find Similar
70-piece Christmas ornament set including red and white glitter balls, stars and snowflakes - Red and White Set
70-piece Christmas ornament set in champagne gold and silver with various shapes and sizes - Light Gold Set
70-piece silver Christmas ornament set featuring various baubles, icicles, and pinecones - Silver Jewelry Set
Detailed set of 70 red and gold Christmas ornaments including stars and snowflakes - Red Green and Gold Set
+2
Christmas Tree Ornaments Balls Shatterproof Plastic Mixed Shapes Hanging Decorations Festive Holiday Home Party Decor
$19.60
Mix MOQ : 10
Christmas Window Stickers PVC Static Cling Snowflake Santa Claus Elk Reindeer Decals For Glass Door Home Holiday Decor
Christmas Window Stickers PVC Static Cling Snowflake Santa Claus Elk Reindeer Decals For Glass Door Home Holiday Decor
like
Find Similar
Christmas Santa Claus static window sticker set with snowflakes measuring 20x30 cm - BQ472 Santa Claus
Christmas reindeer static sticker BQ473 layout with snowflakes and bells for window decor - BQ473 Reindeer
Christmas snowman static window decal set with snowflake stickers measuring 20x30cm - BQ474 Snowman
White Christmas window sticker set with snowflakes and stocking icons measuring 20x30cm - BQ475 Christmas Stocking
+18
Christmas Window Stickers PVC Static Cling Snowflake Santa Claus Elk Reindeer Decals For Glass Door Home Holiday Decor
$0.26-2.16
Mix MOQ : 2
3D Christmas Wall Stickers Acrylic Crystal Gloss Santa Claus Christmas Tree Decals Home Decor Waterproof Self Adhesive
3D Christmas Wall Stickers Acrylic Crystal Gloss Santa Claus Christmas Tree Decals Home Decor Waterproof Self Adhesive
like
Find Similar
Acrylic 3D Christmas Santa Claus wall sticker with gloss finish and snowflake details - SJ016 Balancing Scooter / Small
3D Santa Claus and snowman crystal wall stickers with glossy finish for Christmas decor - SJ017 Treasure Hunt / Small
3D crystal Christmas tree wall sticker with Santa Claus motif in small or large size - SJ018 Peace Prayer / Small
3D Christmas tree crystal wall sticker with Santa and Reindeer designs in small and large - SJ019 Snow Movement / Small
+8
3D Christmas Wall Stickers Acrylic Crystal Gloss Santa Claus Christmas Tree Decals Home Decor Waterproof Self Adhesive
$1.43-2.26
No MOQ
Vintage Christmas Stickers Boxed Festive Illustration Adhesive Decorative Decals For Scrapbooking Journal Gift Wrapping
Vintage Christmas Stickers Boxed Festive Illustration Adhesive Decorative Decals For Scrapbooking Journal Gift Wrapping
like
Find Similar
Christmas tree themed boxed stickers with 46 pieces of hand-drawn decorative paper - A Touch of Christmas Green
Vintage Christmas sticker set with retro girl and holiday motifs in red plaid box - Silent Christmas Night
Vintage Christmas Stickers Boxed Festive Illustration Adhesive Decorative Decals For Scrapbooking Journal Gift Wrapping
$0.57
Mix MOQ : 8
Christmas Scrapbook Material Paper Vintage Reindeer Santa Claus Patterns Junk Journal Decorative Crafting Supplies
Christmas Scrapbook Material Paper Vintage Reindeer Santa Claus Patterns Junk Journal Decorative Crafting Supplies
like
Find Similar
1 option
Christmas Scrapbook Material Paper Vintage Reindeer Santa Claus Patterns Junk Journal Decorative Crafting Supplies
$1.21
No MOQ
 · 
22 sold recently
Christmas Snow Globe Lantern Musical Water Globe Vintage Trolley Ornament LED Light Automatic Snowing Holiday Table Decor
Christmas Snow Globe Lantern Musical Water Globe Vintage Trolley Ornament LED Light Automatic Snowing Holiday Table Decor
like
Find Similar
3 options
Christmas Snow Globe Lantern Musical Water Globe Vintage Trolley Ornament LED Light Automatic Snowing Holiday Table Decor
-4%
$20.53
Mix MOQ : 6
Christmas Earrings Green Velvet Ribbon Bow Red Faux Artificial Pearl Drop Alloy Bell Jewelry For Women With Iron Earring Post
Christmas Earrings Green Velvet Ribbon Bow Red Faux Artificial Pearl Drop Alloy Bell Jewelry For Women With Iron Earring Post
like
Find Similar
Detail of Christmas earrings featuring green velvet bows and red beads on a festive red background - Green Velvet Bow with Red Pearl Style
Christmas earrings with festive red fabric bow, green holly leaves and golden bells - Red Bow with Green Leaves and Bells Style
Close-up of a model wearing red and white beaded Christmas earrings with silver hooks - Red White and Black Beaded Abstract Snowman Style
Detail of Christmas bow earrings with red bead charms worn by a model on white background - Green Ribbon with Red Apple Fruit Style
Christmas Earrings Green Velvet Ribbon Bow Red Faux Artificial Pearl Drop Alloy Bell Jewelry For Women With Iron Earring Post
$0.50-0.92
Mix MOQ : 2
Free Shipping
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access