Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Halloween Christmas Door Banner Porch Sign Nonwoven Fabric Vertical Hanging Couplet For Outdoor Indoor Holiday Party Decor
Halloween Christmas Door Banner Porch Sign Nonwoven Fabric Vertical Hanging Couplet For Outdoor Indoor Holiday Party Decor
like
Find Similar
Detailed view of Trick or Treat Halloween door banners set in vibrant orange and black - Halloween 3-Piece Set / Yellow
Three-piece Halloween banner set with red Trick or Treat text and skull motifs on black - Halloween 3-Piece Set / Black
Halloween Christmas Door Banner Porch Sign Nonwoven Fabric Vertical Hanging Couplet For Outdoor Indoor Holiday Party Decor
$4.32
No MOQ
LED Curtain Lights String Plastic Christmas Decoration Warm White USB Powered Remote Control Multiple Modes Star Tree Shape Indoor Window
LED Curtain Lights String Plastic Christmas Decoration Warm White USB Powered Remote Control Multiple Modes Star Tree Shape Indoor Window
like
Find Similar
Star-shaped LED Christmas curtain light with warm white glow and 8 mode remote control - Star Style
Warm white LED Christmas star and snowflake icicle lights with USB remote control - Five-Pointed Star with Snowflake Style
LED Curtain Lights String Plastic Christmas Decoration Warm White USB Powered Remote Control Multiple Modes Star Tree Shape Indoor Window
$19.83-22.71
No MOQ
Christmas Glowing Gift Boxes Decoration Iron Mesh LED Light Ornaments With Bow Pine Needle Berry Holiday Scene Prop
Christmas Glowing Gift Boxes Decoration Iron Mesh LED Light Ornaments With Bow Pine Needle Berry Holiday Scene Prop
like
Find Similar
Three-piece red Christmas lighted gift boxes with burlap bows and pine needle accents - Red Mesh Style (T1200431) / Large Medium Small Combination / Red
Three-piece set of golden wire mesh Christmas gift boxes with red bows and pine accents - Large Medium Small Combination / Gold
Three-piece set of LED lighted Christmas gift boxes with rustic pine needles and cones - Snowman Snowflake Print Style (2022-151) / Large Medium Small Combination / Hemp Color
Three-piece set of white LED Christmas gift box decorations with burlap bows and pine needles - Large Medium Small Combination / White
+2
Christmas Glowing Gift Boxes Decoration Iron Mesh LED Light Ornaments With Bow Pine Needle Berry Holiday Scene Prop
-5%
$16.43-18.62
Mix MOQ : 2
 · 
17 views
Christmas Teardrop Swag Faux Pine Door Hanging Ornament Gold Green Plastic Balls Fabric Ribbon Bow LED Light Home Decor
Christmas Teardrop Swag Faux Pine Door Hanging Ornament Gold Green Plastic Balls Fabric Ribbon Bow LED Light Home Decor
like
Find Similar
Christmas teardrop swag with green PVC pine needles, gold balls and Santa Claus ribbon - No Light Version
Christmas teardrop swag with green ribbons, golden ornaments and LED lights on white door - With Lights
Christmas Teardrop Swag Faux Pine Door Hanging Ornament Gold Green Plastic Balls Fabric Ribbon Bow LED Light Home Decor
$1.44-10.95
Mix MOQ : 2
Wall Hanging Wooden Christmas Tree With LED String Lights Festive DIY Ornaments For Holiday Home Wall Door Decor
Wall Hanging Wooden Christmas Tree With LED String Lights Festive DIY Ornaments For Holiday Home Wall Door Decor
like
Find Similar
Hanging wooden branch Christmas tree with warm LED lights and assorted ornaments - Wooden Wall Hanging Style 1
Handmade wooden DIY wall Christmas tree with LED lights and festive hanging ornaments - Wooden Wall Hanging Style 4
Hanging wooden Christmas tree ladder with warm LED lights and assorted festive ornaments - Wooden Wall Hanging Style 3
93cm wooden ladder Christmas tree wall hanging with LED lights and festive ornaments - Wooden Wall Hanging Style 2
+2
Wall Hanging Wooden Christmas Tree With LED String Lights Festive DIY Ornaments For Holiday Home Wall Door Decor
-5%
$16.70
No MOQ
Christmas Socks Cotton Knit Cartoon Santa Reindeer Pattern Mid Tube Festive Holiday Warm For Kids Boys Girls Students
Christmas Socks Cotton Knit Cartoon Santa Reindeer Pattern Mid Tube Festive Holiday Warm For Kids Boys Girls Students
like
Find Similar
Cute cartoon Christmas cotton socks featuring festive snowman and reindeer patterns - S (Approx. 1-3 Years) / Christmas Style A
Five pairs of festive Christmas cotton socks featuring Santa, reindeer, and tree patterns - S (Approx. 1-3 Years) / Christmas Style C
+6
Christmas Socks Cotton Knit Cartoon Santa Reindeer Pattern Mid Tube Festive Holiday Warm For Kids Boys Girls Students
$0.69
Mix MOQ : 5
Christmas Wooden Tree Reindeer Desktop Decoration Hollow Out Ornament Hanging Sign With Hemp Rope Bell Holiday Party Home Decor
Christmas Wooden Tree Reindeer Desktop Decoration Hollow Out Ornament Hanging Sign With Hemp Rope Bell Holiday Party Home Decor
like
Find Similar
Wooden Christmas tree tabletop decor with snowman design and festive star topper - WTH-306B (Snowman Tree)
Light green wooden Christmas tree desk decor with bow and star hanging ornaments - Small (Light Green)
Blue wooden Christmas tree tabletop decoration with white stars and festive bow - Large (Teal)
Wooden Christmas tree tabletop ornament with deer and snowmen festive decor - Tree & Reindeer (Right Tree Style A)
+4
Christmas Wooden Tree Reindeer Desktop Decoration Hollow Out Ornament Hanging Sign With Hemp Rope Bell Holiday Party Home Decor
$4.27-7.44
No MOQ
Free Shipping
Christmas Greeting Cards Gold Stamping Foldable Cartoon Holiday Gift Message Notes For Bakery Flower Shop Gratitude
Christmas Greeting Cards Gold Stamping Foldable Cartoon Holiday Gift Message Notes For Bakery Flower Shop Gratitude
like
Find Similar
Pink Christmas folding cards with gold Merry Christmas text and stylized tree illustration - Christmas Tree【Pink】
Red and beige 3D Christmas greeting cards set with Santa Claus and hearts - Santa Claus【Red】
Green fold-out Christmas card set with gold Merry Christmas lettering on wood background - Christmas Wreath【Green】
Pink 3D pop-up Christmas card with gift box design and golden Merry Christmas text - Christmas Gift【Pink】
+1
Christmas Greeting Cards Gold Stamping Foldable Cartoon Holiday Gift Message Notes For Bakery Flower Shop Gratitude
$0.06
Mix MOQ : 10
 · 
10 views
Christmas Snow Globe Luminous Music House Ornament Santa Claus Micro Landscape Resin Plastic Tabletop Festive Decor Gift
Christmas Snow Globe Luminous Music House Ornament Santa Claus Micro Landscape Resin Plastic Tabletop Festive Decor Gift
like
Find Similar
Luminous Christmas music house decoration in a festive red snow globe sphere - YL-2302 Glowing Musical Red Christmas Ball House
Christmas Snow Globe Luminous Music House Ornament Santa Claus Micro Landscape Resin Plastic Tabletop Festive Decor Gift
$15.85
Mix MOQ : 2
Christmas Wooden Hanging Ornaments Painted Reindeer Santa Red Truck Rocking Horse House Tree Festive Holiday Home Party Decor
Christmas Wooden Hanging Ornaments Painted Reindeer Santa Red Truck Rocking Horse House Tree Festive Holiday Home Party Decor
like
Find Similar
Christmas wooden house ornament with snowman design, 10cm height, hanging on tree branch - Wooden House Style D (Snowman)
Christmas reindeer wooden hanging ornament with Let's Be Jolly text for tree decoration - Wooden Pendant Style E (Elk)
Green wooden Christmas tree ornament with Welcome text and star, 10x6cm size - Wooden Pendant Style F (Christmas Tree)
Red vintage wooden Christmas truck ornament with Santa and Welcome text 13.5x7.5cm - Wooden Christmas Car Style H (Santa)
+6
Christmas Wooden Hanging Ornaments Painted Reindeer Santa Red Truck Rocking Horse House Tree Festive Holiday Home Party Decor
-5%
$0.99-1.73
No MOQ
Free Shipping
Acrylic Fondant Embossing Mold Cookie Stamps Holiday Greeting Words For Baking Cake Decoration DIY Crafting
Acrylic Fondant Embossing Mold Cookie Stamps Holiday Greeting Words For Baking Cake Decoration DIY Crafting
like
Find Similar
Arch-shaped Merry Christmas fondant stamp tool for holiday baking and cake decoration - Merry Christmas
Acrylic Happy Birthday fondant stamper for DIY cake decorating and cookie embossing - Happy Birthday
Acrylic Happy Father's Day cookie stamp, 5.5x2.4cm arch mold for cake decorating - Happy Father's Day
Happy Mother's Day acrylic fondant stamp for cake and cookie baking decoration - Happy Mother's Day
+6
Acrylic Fondant Embossing Mold Cookie Stamps Holiday Greeting Words For Baking Cake Decoration DIY Crafting
-4%
$4.00
Mix MOQ : 2
Free Shipping
LED Christmas Icicle String Lights Star Tree Hanging Decorations With Micro Figurines Remote Control Window Curtain Decor
LED Christmas Icicle String Lights Star Tree Hanging Decorations With Micro Figurines Remote Control Window Curtain Decor
like
Find Similar
Colorful LED star icicle lights with remote and battery box for festive decoration - Battery Remote [120 LEDs] / Snowflake Star Ring [Multicolor]
Warm white LED curtain lights with stars, Christmas trees and reindeer figurines - Battery Remote [120 LEDs] / Snowflake Star + Tree Ring [Warm White]
3m Warm White LED Starry Ring Icicle Lights with Santa Ornaments and 8 Remote Modes - Battery Remote [120 LEDs] / Snowflake Wish Ring [Warm White]
LED pentagram curtain lights with warm white stars and Christmas theme ornaments - Battery Remote [120 LEDs] / Snowflake Star Ring [Warm White]
+16
LED Christmas Icicle String Lights Star Tree Hanging Decorations With Micro Figurines Remote Control Window Curtain Decor
$9.22
No MOQ
LED Christmas Curtain Fairy Lights Remote Multi Mode USB Battery Powered Hanging Ornaments For Home Window Decor
LED Christmas Curtain Fairy Lights Remote Multi Mode USB Battery Powered Hanging Ornaments For Home Window Decor
like
Find Similar
Christmas tree LED icicle lights with USB remote and 8 modes for festive decor - USB Remote Control / Snowflake Christmas Tree Ring
Christmas LED curtain lights with Santa and snowman figurines and remote control - USB Remote Control / Snowflake Wish Ring + Xmas Tree Ring
Multicolor LED Christmas window curtain lights with stars, reindeer, and remote control - USB Remote Control / Snowflake Star Ring + Xmas Tree Ring
Christmas LED curtain lights with stars and snowflake pendants featuring Santa and snowmen - USB Remote Control / Snowflake Star Ring
+4
LED Christmas Curtain Fairy Lights Remote Multi Mode USB Battery Powered Hanging Ornaments For Home Window Decor
$9.22
No MOQ
Christmas Window Stickers Static Cling PVC Gingerbread Man Candy Cane Snowflake Holiday Decor Double Sided Window Decals
Christmas Window Stickers Static Cling PVC Gingerbread Man Candy Cane Snowflake Holiday Decor Double Sided Window Decals
like
Find Similar
Set of 6 Christmas gingerbread man electrostatic stickers for festive window decoration - Gingerbread Man & Candy Style / 20cm*30cm*6 Sheets
Detail view of 6-sheet Christmas static window clings with snowflakes and reindeer motifs - Christmas Tree & Snowflakes Style / 20cm*30cm*6 Sheets
Christmas Window Stickers Static Cling PVC Gingerbread Man Candy Cane Snowflake Holiday Decor Double Sided Window Decals
-5%
$1.51
No MOQ
Christmas Stickers Boxed Coated Paper Cartoon Santa Reindeer Gingerbread Man Scrapbooking Journal DIY Gift Sealing Decor
Christmas Stickers Boxed Coated Paper Cartoon Santa Reindeer Gingerbread Man Scrapbooking Journal DIY Gift Sealing Decor
like
Find Similar
46-piece set of hand-drawn watercolor Christmas stickers with reindeer and tree motifs - Fondant Christmas 46Pcs
Set of 45 Christmas themed stickers, 38mm round festive DIY holiday labels - Christmas Wishes 45Pcs
Christmas Stickers Boxed Coated Paper Cartoon Santa Reindeer Gingerbread Man Scrapbooking Journal DIY Gift Sealing Decor
$0.47
Mix MOQ : 8
 · 
32 sold recently
Christmas Press On Nails ABS Resin Snowflake Santa Claus Reindeer Patterns Holiday Winter Festive Cartoon Glossy Matte
Christmas Press On Nails ABS Resin Snowflake Santa Claus Reindeer Patterns Holiday Winter Festive Cartoon Glossy Matte
like
Find Similar
Detailed view of Christmas press-on nails with 24pcs red, green and white festive patterns - XMAS003 Classic Red Christmas
Christmas press-on nail set featuring red heart and snowflake designs on long pointed nails - XMAS004 Red Heart Christmas
Detail of Christmas press-on nails with Santa Claus and snowflake designs on glossy resin - XMAS005 Snowman Gold Glitter Christmas
Christmas press-on nails set with red reindeer and white snowflake festive designs - XMAS006 Red White French Reindeer
+18
Christmas Press On Nails ABS Resin Snowflake Santa Claus Reindeer Patterns Holiday Winter Festive Cartoon Glossy Matte
-5%
$0.35-0.44
No MOQ
 · 
13 views
Christmas Window Stickers Static Cling PVC Reusable Waterproof Double Sided Santa Reindeer Snowflake Festive Home Shop Decor
Christmas Window Stickers Static Cling PVC Reusable Waterproof Double Sided Santa Reindeer Snowflake Festive Home Shop Decor
like
Find Similar
Merry Christmas electrostatic glass sticker with Santa and Reindeer, size 30x65cm - Moon Boat (XL6118)
Christmas Santa Claus sleigh and reindeer double-sided window stickers measuring 82x56cm - Christmas Sleigh (XL6122)
Christmas window sticker with Santa, reindeer and moon motif, 68x72cm static cling - Above the Moon (XL6116)
Christmas static window stickers with Santa, snowman and Merry Christmas text decor - Happy Santa (XL6113)
+12
Christmas Window Stickers Static Cling PVC Reusable Waterproof Double Sided Santa Reindeer Snowflake Festive Home Shop Decor
-4%
$0.99
No MOQ
Christmas Polymer Clay Slices Nail Art Decoration Slime Filling Colorful DIY Handmade Crafts Phone Case Accessories
Christmas Polymer Clay Slices Nail Art Decoration Slime Filling Colorful DIY Handmade Crafts Phone Case Accessories
like
Find Similar
Panda polymer clay slices with red Santa hats for DIY slime and nail art decoration - 1-Santa Claus
Beige gingerbread man polymer clay slices for DIY nail art and slime in clear bag - 2-Gingerbread Man
Christmas red gift box polymer clay slices for DIY crafts and slime filler - 3-Gift Box
DIY blue snowflake polymer clay slices for nail art and slime in a resealable bag - 4-Blue Snowflake
+14
Christmas Polymer Clay Slices Nail Art Decoration Slime Filling Colorful DIY Handmade Crafts Phone Case Accessories
$0.29
Mix MOQ : 2
 · 
131 sold recently
Retro Christmas PET Stickers Waterproof Decorative Scrapbooking DIY Material For Journal Holiday Gift Decoration Illustration
Retro Christmas PET Stickers Waterproof Decorative Scrapbooking DIY Material For Journal Holiday Gift Decoration Illustration
like
Find Similar
Retro Christmas sticker pack with birds and bells in a round festive package - Snow Messenger
Retro Christmas Santa Claus stickers for scrapbooking and DIY holiday gift decoration - Joyful Pictures
Vintage Christmas sticker set with pine tree cards and festive PET floral decals - Pine Forest Love Song
Vintage Christmas theme stickers with gold foil details for holiday scrapbooking DIY - Nativity Feast
Retro Christmas PET Stickers Waterproof Decorative Scrapbooking DIY Material For Journal Holiday Gift Decoration Illustration
-5%
$1.20
Mix MOQ : 10
Christmas Window Stickers Static Cling PVC Reusable Santa Reindeer Snowflakes Glass Door Decals Holiday Shop Home Decoration
Christmas Window Stickers Static Cling PVC Reusable Santa Reindeer Snowflakes Glass Door Decals Holiday Shop Home Decoration
like
Find Similar
Detail of Santa and reindeer window static stickers on glass door with Merry Christmas text - AMJ959 (105x75cm)
Detailed view of Santa Claus window stickers with 90x100cm size reference guide - AMJ951 (90x100cm)
Detail of Christmas window stickers featuring Santa and reindeer on glass doors - AMJ950 (88x88cm)
Scene showing 100x80cm Christmas window clings with penguin, rabbit and elk patterns - AMJ952 (100x80cm)
+6
Christmas Window Stickers Static Cling PVC Reusable Santa Reindeer Snowflakes Glass Door Decals Holiday Shop Home Decoration
-5%
$1.23-4.01
Mix MOQ : 2
Christmas Stickers Book Vintage Gold Stamping Washi Paper Decals For Journaling Scrapbooking Holiday DIY Decoration
Christmas Stickers Book Vintage Gold Stamping Washi Paper Decals For Journaling Scrapbooking Holiday DIY Decoration
like
Find Similar
6 options
Christmas Stickers Book Vintage Gold Stamping Washi Paper Decals For Journaling Scrapbooking Holiday DIY Decoration
-11%
$0.76
Mix MOQ : 10
 · 
10 sold recently
Christmas Static Window Stickers PVC Double Sided Removable Glass Decals Santa Reindeer Balloon Holiday Party Decor
Christmas Static Window Stickers PVC Double Sided Removable Glass Decals Santa Reindeer Balloon Holiday Party Decor
like
Find Similar
Detailed view of Christmas static stickers with Santa, snowflakes, and festive balloons - BQ177-Christmas Elements Mix
Christmas Static Window Stickers PVC Double Sided Removable Glass Decals Santa Reindeer Balloon Holiday Party Decor
$0.52
Mix MOQ : 2
Christmas Window Stickers Static Cling Reusable PVC Santa Claus Reindeer Snowflake Holiday Glass Decals White Shop Window
Christmas Window Stickers Static Cling Reusable PVC Santa Claus Reindeer Snowflake Holiday Glass Decals White Shop Window
like
Find Similar
9-piece blue Christmas window sticker set with 200 snowflake and Santa decals - Pendant Christmas Tree (9 Sheets/Set)
Christmas window stickers set with 8 sheets of Santa Snowman and Reindeer decals - Santa Claus Snowman (8 Sheets/Set)
9-piece set of blue and white Christmas static window stickers with Santa and reindeer - Snow Cedar Cabin Lamp (9 Sheets/Set)
9-piece set of 20x30cm Christmas stencils featuring Santa, reindeer, and snowflakes patterns - City Santa Claus Reindeer (9 Sheets/Set)
+4
Christmas Window Stickers Static Cling Reusable PVC Santa Claus Reindeer Snowflake Holiday Glass Decals White Shop Window
$2.16-2.88
Mix MOQ : 2
Christmas Window Stickers Static Cling Decals White Snowflake Santa Reindeer Winter Holiday Glass Showcase Decor
Christmas Window Stickers Static Cling Decals White Snowflake Santa Reindeer Winter Holiday Glass Showcase Decor
like
Find Similar
Set of 8 Christmas window stickers with Santa, reindeer and snowman, size 20x30cm each - 20*30CM*8 Sheets
Christmas Window Stickers Static Cling Decals White Snowflake Santa Reindeer Winter Holiday Glass Showcase Decor
$2.31
No MOQ
Christmas Stickers Cartoon PET Waterproof Transparent DIY Decals For Journal Phone Case Water Bottle Kawaii Holiday Decorative
Christmas Stickers Cartoon PET Waterproof Transparent DIY Decals For Journal Phone Case Water Bottle Kawaii Holiday Decorative
like
Find Similar
Cute Christmas cartoon PET stickers with Santa and penguin motifs for DIY decoration - Christmas Pets Stickers A
Cute Christmas PET stickers featuring Santa and gingerbread man for DIY decoration - Christmas Pets Stickers C
Cute Christmas cartoon PET stickers set with Santa, reindeer and snowman for DIY decor - Christmas Pets Stickers D
Christmas Stickers Cartoon PET Waterproof Transparent DIY Decals For Journal Phone Case Water Bottle Kawaii Holiday Decorative
$0.12
No MOQ
 · 
14 views
Christmas Window Stickers Static Cling PVC Double Sided Santa Claus Owl Snowflake Holiday Glass Decals Decoration
Christmas Window Stickers Static Cling PVC Double Sided Santa Claus Owl Snowflake Holiday Glass Decals Decoration
like
Find Similar
8-sheet Christmas window clings set featuring Santa, owls, and snowflakes in 20x30cm size - Set of 8 Sheets (20*30CM)
Christmas Window Stickers Static Cling PVC Double Sided Santa Claus Owl Snowflake Holiday Glass Decals Decoration
-5%
$2.05
No MOQ
Wooden Seasonal Welcome Sign Interchangeable Gnome Door Hanger Buffalo Plaid Home Decor Rustic Holiday Front Door Hanging
Wooden Seasonal Welcome Sign Interchangeable Gnome Door Hanger Buffalo Plaid Home Decor Rustic Holiday Front Door Hanging
like
Find Similar
Wooden HOME Sweet GNOME door sign with 12 interchangeable seasonal icons for holiday decor - HOME Sweet GNOME Style (With Interchangeable Icons)
Welcome wooden door sign with buffalo plaid pattern and 12 interchangeable holiday icons - Welcome Style (With Interchangeable Icons)
Wooden Seasonal Welcome Sign Interchangeable Gnome Door Hanger Buffalo Plaid Home Decor Rustic Holiday Front Door Hanging
$8.65
No MOQ
Christmas Garland Hanging Ornament Chain With Wood Santa Reindeer Pine Cones And Glitter Balls For Festive Home Decor
Christmas Garland Hanging Ornament Chain With Wood Santa Reindeer Pine Cones And Glitter Balls For Festive Home Decor
like
Find Similar
1.65m Christmas garland with wooden snowman, reindeer and red gift box ornaments - Christmas Chain Style B
1.66m Christmas garland with pine cones, red glitter balls and wooden Santa ornaments - Christmas Chain Style A
1.66m Christmas garland with gold glitter balls, red gift boxes and wooden deer pendants - Christmas Chain Style C
1.65m Christmas garland with golden beads, wooden reindeer, and Santa Claus charms - Christmas Chain Style D
Christmas Garland Hanging Ornament Chain With Wood Santa Reindeer Pine Cones And Glitter Balls For Festive Home Decor
-4%
$5.15
No MOQ
Santa Claus Christmas Tree Hanging Ornament Painted Resin Wooden Vintage Holiday Party Decor Merry Christmas Sign
Santa Claus Christmas Tree Hanging Ornament Painted Resin Wooden Vintage Holiday Party Decor Merry Christmas Sign
like
Find Similar
Hand-painted Santa Claus Christmas tree hanging ornament with Merry Christmas sign - Large Santa Claus Style A
Vintage painted wooden Santa Claus pendant with Merry Christmas sign and bell - Large Santa Claus Style B
Santa Claus Christmas tree hanging ornament with Merry Christmas sign and green gift box - Small Santa Claus Style A
Festive Santa Claus resin ornament with Merry Christmas sign on pine branch - Small Santa Claus Style D
+4
Santa Claus Christmas Tree Hanging Ornament Painted Resin Wooden Vintage Holiday Party Decor Merry Christmas Sign
-4%
$2.88-3.81
No MOQ
Free Shipping
Christmas Hanging Ornaments Wood Wool Felt Reindeer Star Snowflake Bell Red White Nordic Holiday Xmas Tree Decorations
Christmas Hanging Ornaments Wood Wool Felt Reindeer Star Snowflake Bell Red White Nordic Holiday Xmas Tree Decorations
like
Find Similar
Handmade Christmas wool felt and wood ornaments set featuring Santa, reindeer and tree - Type A Red Wooden Ornament Set
Red and white wool felt Christmas ornaments with wooden elements for tree decoration - Type B Red Wooden Ornament Set
5-piece wooden Christmas tree pendant set with reindeer star snowflake and bell designs - Type C White Wooden Ornament Set
Christmas wooden reindeer and bell ornaments with snowflake prints for festive trees - Type D Red & White Wooden Ornament Set
+2
Christmas Hanging Ornaments Wood Wool Felt Reindeer Star Snowflake Bell Red White Nordic Holiday Xmas Tree Decorations
$2.16-10.09
No MOQ
Free Shipping
Christmas Window Clings PVC Static Film Reusable Snowflake Reindeer Santa For Glass Window Door Showcase Holiday Decor
Christmas Window Clings PVC Static Film Reusable Snowflake Reindeer Santa For Glass Window Door Showcase Holiday Decor
like
Find Similar
Christmas window stickers set with Santa, reindeer and snowflakes for festive decor - Christmas Hanging Ornament XC004 / White
Detailed view of Christmas window stickers featuring Santa, snowmen, and reindeer designs - Christmas Elements Set AMJ034
Christmas window stickers featuring Santa, snowman, and reindeer on shop glass - XC004+AMJ034 Combination Set
White snowflake static window stickers set in 30x43cm size for Christmas holiday decor - Snowflake Theme XC001B / White
Christmas Window Clings PVC Static Film Reusable Snowflake Reindeer Santa For Glass Window Door Showcase Holiday Decor
$0.92-2.88
Mix MOQ : 2
LED Christmas Tree Warm Light Prelit Artificial Branch Ornaments Home Indoor Holiday Decoration Festive Winter Decor
LED Christmas Tree Warm Light Prelit Artificial Branch Ornaments Home Indoor Holiday Decoration Festive Winter Decor
like
Find Similar
1.5m glowing Christmas tree with 36 red-green balls and 78cm white plush skirt - 1.5m Colorful Ball Light Tree
1.5m glowing Christmas tree set with 36 red-green balls, snowmen, and LED gift boxes - Full Set (With Snowman/Gift Box) / 1.5m Colorful Ball Light Tree Set
1.5m glowing LED decorative tree with warm white lights and white faux fur base mat - 1.5m Glowing Tree
1.5m Christmas tree with warm LED lights, blue ornaments, and white plush tree skirt - 1.5m Blue Ball Light Tree
+3
LED Christmas Tree Warm Light Prelit Artificial Branch Ornaments Home Indoor Holiday Decoration Festive Winter Decor
-5%
$29.57-98.01
No MOQ
Christmas Tree Ornaments Decoration Collection Plush Fabric Wooden Hanging Pendants Nordic Style Gnome Doll For Holiday Party
Christmas Tree Ornaments Decoration Collection Plush Fabric Wooden Hanging Pendants Nordic Style Gnome Doll For Holiday Party
like
Find Similar
21-piece Christmas tree ornament set in gray and white tones featuring felt reindeer and plush dolls - 21-Piece Set / Grey Set
Christmas Tree Ornaments Decoration Collection Plush Fabric Wooden Hanging Pendants Nordic Style Gnome Doll For Holiday Party
$57.06
No MOQ
Free Shipping
Christmas Window Static Stickers Santa Claus Reindeer Wreath PVC Double Sided Glass Decals Holiday Party Shop Decor
Christmas Window Static Stickers Santa Claus Reindeer Wreath PVC Double Sided Glass Decals Holiday Party Shop Decor
like
Find Similar
Detailed size guide for Christmas window decals showing layout and 88x88cm setup - Santa Claus Wreath
Christmas Window Static Stickers Santa Claus Reindeer Wreath PVC Double Sided Glass Decals Holiday Party Shop Decor
-4%
$1.37
Mix MOQ : 2
Christmas Stickers Washi Paper Self Adhesive Cartoon Santa Claus Reindeer For Scrapbooking DIY Diary Journal Decoration
Christmas Stickers Washi Paper Self Adhesive Cartoon Santa Claus Reindeer For Scrapbooking DIY Diary Journal Decoration
like
Find Similar
Style A Christmas washi paper stickers with Santa and bear patterns for journaling - Happy Christmas Sticker Style A
Cute Santa and Christmas tree washi paper stickers for scrapbooking 11x20cm - Happy Christmas Sticker Style B
Christmas Santa and reindeer washi paper sticker sheet for scrapbooking style C 11x20cm - Happy Christmas Sticker Style C
Cute Christmas Washi stickers set with Santa and reindeer designs in 11x20CM size - Happy Christmas Sticker Style D
+2
Christmas Stickers Washi Paper Self Adhesive Cartoon Santa Claus Reindeer For Scrapbooking DIY Diary Journal Decoration
$0.14
No MOQ
 · 
18 views
Christmas Stickers Cartoon Santa Reindeer PET Waterproof Decals For Journal Scrapbooking DIY Decoration Cute Aesthetic
Christmas Stickers Cartoon Santa Reindeer PET Waterproof Decals For Journal Scrapbooking DIY Decoration Cute Aesthetic
like
Find Similar
PET Christmas sticker sheet featuring cartoon Santa and reindeer for journaling decoration - Style B
Christmas transparent PET sticker sheet C style with Santa and gingerbread man 11x20cm - Style C
Christmas PET stickers set featuring Santa and reindeer designs in 11x20CM size - Style D
Christmas Stickers Cartoon Santa Reindeer PET Waterproof Decals For Journal Scrapbooking DIY Decoration Cute Aesthetic
$0.14
No MOQ
Christmas Tree Hanging Ornaments Transparent Acrylic Glitter Moose Angel Snowflake Bird Key Wreath Dancer Nordic
Christmas Tree Hanging Ornaments Transparent Acrylic Glitter Moose Angel Snowflake Bird Key Wreath Dancer Nordic
like
Find Similar
Clear acrylic reindeer ornament with silver glitter antlers for Christmas tree decor - Sitting Deer (55g)
Transparent acrylic snowflake ornament with white glitter finish for Christmas tree - Snowflake A (30g)
Clear acrylic flying bird Christmas ornament with silver glitter finish for festive decor - Flying Bird (30g)
Transparent acrylic Christmas key ornament with glitter finish hanging on tree branch - Key (20g)
+4
Christmas Tree Hanging Ornaments Transparent Acrylic Glitter Moose Angel Snowflake Bird Key Wreath Dancer Nordic
-5%
$2.41-3.01
No MOQ
Free Shipping
5D Embossed Christmas Nail Stickers 3D Self-Adhesive Santa Claus Reindeer Snowflake Decals For DIY Manicure Decoration
5D Embossed Christmas Nail Stickers 3D Self-Adhesive Santa Claus Reindeer Snowflake Decals For DIY Manicure Decoration
like
Find Similar
5D embossed Christmas nail stickers TS-931 with Santa and reindeer relief patterns - TS-931 Merry Christmas Embossed
5D embossed Christmas nail stickers featuring gingerbread man and Santa TS-935 - TS-935 Christmas Fairytale Embossed
5D embossed Christmas nail stickers featuring Santa Claus and reindeer designs TS-936 - TS-936 Christmas Surprise Embossed
5D embossed Christmas alphabet nail stickers with gingerbread style letters and icons - TS-941 Christmas Letters Embossed
5D Embossed Christmas Nail Stickers 3D Self-Adhesive Santa Claus Reindeer Snowflake Decals For DIY Manicure Decoration
$1.30
No MOQ
 · 
10 views
Free Shipping
Christmas Tree Hanging Ornaments Transparent Acrylic Snowflake Icicle Pendants For Holiday Party Decor Nordic Style
Christmas Tree Hanging Ornaments Transparent Acrylic Snowflake Icicle Pendants For Holiday Party Decor Nordic Style
like
Find Similar
Transparent acrylic icicle ornament for Christmas tree decoration with 17cm length - Icicle
Clear acrylic snowflake and icicle ornament, 6.5x21cm hanging Christmas tree decoration - Snowflake String E
Clear acrylic snowflake pendant with three crystals and water drop for Christmas trees - Snowflake String B
Clear acrylic Christmas snowman and snowflake pendant on green pine branch with bokeh - Snowflake String F
+4
Christmas Tree Hanging Ornaments Transparent Acrylic Snowflake Icicle Pendants For Holiday Party Decor Nordic Style
$1.15-1.67
No MOQ
 · 
36 sold recently
Free Shipping
Christmas Hair Clips And Ties Handmade Fabric Sequin Santa Reindeer Tree Holiday Party Hair Accessories For Girls
Christmas Hair Clips And Ties Handmade Fabric Sequin Santa Reindeer Tree Holiday Party Hair Accessories For Girls
like
Find Similar
Close-up of 8-piece Christmas hair accessories set with Santa and reindeer motifs - 5# Christmas Hat Set
Close-up of Christmas hair clip set with knit trees and glittery reindeer bows - 3# Christmas Tree Set
Christmas Hair Clips And Ties Handmade Fabric Sequin Santa Reindeer Tree Holiday Party Hair Accessories For Girls
$1.99
No MOQ
Christmas Snow Globe Lantern Music Box Retro LED Night Light Swirling Glitter Ornament Santa Claus Holiday Home Decor
Christmas Snow Globe Lantern Music Box Retro LED Night Light Swirling Glitter Ornament Santa Claus Holiday Home Decor
like
Find Similar
2 options
Christmas Snow Globe Lantern Music Box Retro LED Night Light Swirling Glitter Ornament Santa Claus Holiday Home Decor
$23.05
Mix MOQ : 2
Christmas Stickers PVC Waterproof Cartoon Graffiti Holiday Decoration For Laptop Luggage Skateboard
Christmas Stickers PVC Waterproof Cartoon Graffiti Holiday Decoration For Laptop Luggage Skateboard
like
Find Similar
Pack of 100 assorted Christmas graffiti stickers with Santa, Reindeer, and Snowman designs - 100PCS Non-repeating Christmas Stickers
Christmas Stickers PVC Waterproof Cartoon Graffiti Holiday Decoration For Laptop Luggage Skateboard
$2.54
No MOQ
Christmas Window Clings Static Stickers PVC Reusable Double Sided Glass Decoration Santa Reindeer Snowflake Festive Decals
Christmas Window Clings Static Stickers PVC Reusable Double Sided Glass Decoration Santa Reindeer Snowflake Festive Decals
like
Find Similar
Size chart for Christmas glass window stickers showing hanging ornament dimensions - Christmas Pendant Sticker BQ085
Detailed view of Christmas static stickers with Santa, snowflakes, and festive balloons - Christmas Balloon BQ177
Detailed sheet of Christmas static window clings with Santa Claus, snowmen and reindeer - Colorful Hanging Ball BQ027
Detailed view of 4-piece set of gold Christmas window stickers with festive snowflakes - Gold Hanging Ball BQ150
+4
Christmas Window Clings Static Stickers PVC Reusable Double Sided Glass Decoration Santa Reindeer Snowflake Festive Decals
-5%
$0.49-1.04
Mix MOQ : 2
Christmas Wall Stickers PVC Waterproof Self Adhesive Santa Claus Reindeer Snowflakes Merry Christmas Window Decals
Christmas Wall Stickers PVC Waterproof Self Adhesive Santa Claus Reindeer Snowflakes Merry Christmas Window Decals
like
Find Similar
DIY Santa and Reindeer Christmas wall sticker for window glass decoration 60x45cm - Sheet Size 45x60cm
Christmas Wall Stickers PVC Waterproof Self Adhesive Santa Claus Reindeer Snowflakes Merry Christmas Window Decals
$0.82
No MOQ
Christmas Snow Globe Lantern Lighted Music Snowing Decorative Vintage Desktop Ornament Plastic Resin Glass
Christmas Snow Globe Lantern Lighted Music Snowing Decorative Vintage Desktop Ornament Plastic Resin Glass
like
Find Similar
Red vintage Christmas lantern snow globe with Santa Claus, tree and gifts inside - Santa Claus
Christmas Snow Globe Lantern Lighted Music Snowing Decorative Vintage Desktop Ornament Plastic Resin Glass
$11.53
Mix MOQ : 2
Christmas Cartoon Graffiti Stickers PVC Waterproof Decals For Suitcase Laptop Refrigerator Holiday Festive Decor Cute DIY
Christmas Cartoon Graffiti Stickers PVC Waterproof Decals For Suitcase Laptop Refrigerator Holiday Festive Decor Cute DIY
like
Find Similar
Colorful waterproof Christmas stickers set featuring Santa, reindeer, and festive patterns - Default
Christmas Cartoon Graffiti Stickers PVC Waterproof Decals For Suitcase Laptop Refrigerator Holiday Festive Decor Cute DIY
$1.91
No MOQ
Christmas Wooden Hanging Signs Santa Claus Gnome Xmas Letter Plaque Festive Home Wall Door Decor Ornaments
Christmas Wooden Hanging Signs Santa Claus Gnome Xmas Letter Plaque Festive Home Wall Door Decor Ornaments
like
Find Similar
Wooden Merry Christmas house ornament with gnome and trees hanging decoration - Type 1 (Merry Christmas House Design)
Wooden XMAS sign decoration featuring Santa Claus and red gift box in 24cm size - Type 2 (XMAS Santa Claus Design)
Wooden Merry Christmas hanging ornament with Santa, red gift car and rustic twine - Type 3 (Merry Christmas Christmas Car Design)
Christmas Wooden Hanging Signs Santa Claus Gnome Xmas Letter Plaque Festive Home Wall Door Decor Ornaments
$1.59-1.67
No MOQ
Welcome Sign Christmas Tree Hanging Ornaments Painted Wood Santa Claus Gift Box Design Rustic Holiday Home Decor
Welcome Sign Christmas Tree Hanging Ornaments Painted Wood Santa Claus Gift Box Design Rustic Holiday Home Decor
like
Find Similar
2 options
Welcome Sign Christmas Tree Hanging Ornaments Painted Wood Santa Claus Gift Box Design Rustic Holiday Home Decor
-4%
$1.75
No MOQ
Free Shipping
Luminous Snowflake Christmas Stickers PVC Glow In The Dark Window Clings Phosphorescent Wall Decals Holiday Home Decor
Luminous Snowflake Christmas Stickers PVC Glow In The Dark Window Clings Phosphorescent Wall Decals Holiday Home Decor
like
Find Similar
Detailed sheet of Christmas snowflake window stickers including stars and snow dots - BQ028 Luminous Snowflake (Adhesive) / 64-Piece Set
Size chart for snowflake static window decals with dimensions and quantity specifications - BQ028 Luminous Snowflake (Static) / 64-Piece Set
Detailed chart of mint green snowflake window stickers in various sizes and quantities - BQ029 Enhanced Version (Static) / 62pcs Set
Size chart for 64pcs Christmas snowflake window stickers including stars and dots - BQ030 Enhanced Version (Static) / 64-Piece Set
+15
Luminous Snowflake Christmas Stickers PVC Glow In The Dark Window Clings Phosphorescent Wall Decals Holiday Home Decor
$0.43-2.68
Mix MOQ : 2
Christmas Window Clings PVC Static Reusable Stickers For Glass Door Holiday Home Decor Santa Red Truck Snowflake
Christmas Window Clings PVC Static Reusable Stickers For Glass Door Holiday Home Decor Santa Red Truck Snowflake
like
Find Similar
Christmas static window stickers with watercolor red trucks, Santa, and snowman designs - 20x30cm 9 Sheets Set
Christmas Window Clings PVC Static Reusable Stickers For Glass Door Holiday Home Decor Santa Red Truck Snowflake
-5%
$2.05
No MOQ
Christmas Gnome Pillow Case Cover Peach Skin Velvet Square Decorative Cushion Cover For Sofa Couch Home Decor Holiday
Christmas Gnome Pillow Case Cover Peach Skin Velvet Square Decorative Cushion Cover For Sofa Couch Home Decor Holiday
like
Find Similar
Detailed close-up of Christmas gnome pillowcase featuring red hats and Cut and glue text - Style 1
Detailed pattern of turquoise Christmas cushion cover with cute gnomes and festive text - Style 2
Detail of Christmas gnome pillowcase featuring a cute dwarf with lantern on wooden backdrop - Style 3
Close-up of Christmas gnome pillowcase featuring red hat and hanging heart ornaments - Style 4
+35
Christmas Gnome Pillow Case Cover Peach Skin Velvet Square Decorative Cushion Cover For Sofa Couch Home Decor Holiday
-5%
$1.20
Mix MOQ : 2
Christmas Santa Claus Cushion Cover Peach Skin Velvet Cartoon Decorative Pillowcase Holiday Home Decor
Christmas Santa Claus Cushion Cover Peach Skin Velvet Cartoon Decorative Pillowcase Holiday Home Decor
like
Find Similar
Macro shot of red square Christmas pillowcase featuring Santa holding a blank scroll - DRD247-1 (Santa with Scroll)
Detail of red Christmas pillowcase featuring cartoon Santa Claus and decorated tree - DRD247-2 (Santa with Christmas Tree)
Detail of Christmas pillow cover with Santa reading by a festive tree on blue background - DRD247-3 (Santa Reading)
Close-up of Santa Claus pillow cover showing Christmas tree and gift bag details - DRD247-4 (Santa with Gifts)
+19
Christmas Santa Claus Cushion Cover Peach Skin Velvet Cartoon Decorative Pillowcase Holiday Home Decor
-5%
$1.20
Mix MOQ : 2
Christmas Hanging Ornaments Wooden LED Light Up Festive Decor Tree Car Star Heart Shape Battery Operated Hollow Design
Christmas Hanging Ornaments Wooden LED Light Up Festive Decor Tree Car Star Heart Shape Battery Operated Hollow Design
like
Find Similar
Macro view of glowing wooden Christmas ornament with warm LED light and festive hollow carvings - Wooden Luminous Heart Shape
Close-up of a lit wooden star ornament with reindeer silhouette and LED warm glow - Wooden Luminous Star Style
Christmas Hanging Ornaments Wooden LED Light Up Festive Decor Tree Car Star Heart Shape Battery Operated Hollow Design
$2.07
Mix MOQ : 2
Christmas Wreath Artificial Pine Needle Rattan Decoration With Bow Pine Cones Berries Santa Reindeer For Front Door Wall
Christmas Wreath Artificial Pine Needle Rattan Decoration With Bow Pine Cones Berries Santa Reindeer For Front Door Wall
like
Find Similar
Green Christmas wreath with red and gold balls and bows on a white background - Chain Bow Style / Diameter 30cm
Detail of Christmas wreath with pine needles, cones, berries and a burlap bow - Three Large Bows Style / Diameter 30cm
Close-up of a Christmas wreath with pine needles, pine cones, berries, and a burlap bow - Three Small Bows Style / Diameter 30cm
Festive Christmas twig wreath with plush Santa claus decor and natural pine needles - Small Branch Wreath Santa Claus / 35x33cm (Diameter 20cm)
+6
Christmas Wreath Artificial Pine Needle Rattan Decoration With Bow Pine Cones Berries Santa Reindeer For Front Door Wall
-5%
$2.74-4.93
No MOQ
 · 
24 views
Christmas Three Dimensional Cartoon Cookie Mold Eco Friendly PLA Plastic DIY Baking Embossing Cutters Japanese Style Holiday
Christmas Three Dimensional Cartoon Cookie Mold Eco Friendly PLA Plastic DIY Baking Embossing Cutters Japanese Style Holiday
like
Find Similar
Christmas tree cookie cutter mold set with dimensions 3.9x4.5cm for DIY festive baking - Christmas Tree
3.6x3.4cm gift box shaped 3D cookie cutter mold set made of white food grade plastic - Gift
Christmas wreath cookie mold set with plastic cutter and decorative stamp tool - Flower Garland
Christmas reindeer cookie cutter set 4.8x4.2cm for DIY baking cartoon biscuits - Reindeer
+16
Christmas Three Dimensional Cartoon Cookie Mold Eco Friendly PLA Plastic DIY Baking Embossing Cutters Japanese Style Holiday
$1.10-3.60
Mix MOQ : 2
Free Shipping
Merry Christmas Wooden Hanging Sign Glitter Star Xmas Plaque With Hemp Rope For Festive Home Party Tree Decoration
Merry Christmas Wooden Hanging Sign Glitter Star Xmas Plaque With Hemp Rope For Festive Home Party Tree Decoration
like
Find Similar
Wooden XMAS sign decoration featuring Santa Claus and red gift box in 24cm size - Style 2 (XMAS Santa)
Wooden Merry Christmas house ornament with gnome and trees hanging decoration - Style 1 (Merry Christmas House)
Wooden Merry Christmas sign with Santa and red car ornament, 18cm natural wood finish - Style 3 (Christmas Red Car)
Red Merry Christmas wooden sign with white reindeer and hanging rope, 24x10cm size - Style 5 (Red Reindeer)
+2
Merry Christmas Wooden Hanging Sign Glitter Star Xmas Plaque With Hemp Rope For Festive Home Party Tree Decoration
$1.21-3.17
No MOQ
Free Shipping
Patterned Gingerbread House Cookie Cutter Molds Mini Christmas 3D Plastic DIY Baking Tools Holiday Decor
Patterned Gingerbread House Cookie Cutter Molds Mini Christmas 3D Plastic DIY Baking Tools Holiday Decor
like
Find Similar
White plastic 3D Christmas gingerbread house cookie cutter for DIY textured brick walls - E0395-Brick Pattern Press Mold
10-piece set of white 3D Christmas cookie cutters with gingerbread house and snowman shapes - W089 Mini Rings (Without Ring Base)
16-piece white 3D Christmas cookie cutter set featuring trees stars and gingerbread shapes - W51 Christmas Ring Mold (With Ring Base)
Medium 6-piece 3D Christmas gingerbread house cookie cutter set for DIY holiday baking - E0394-Medium House Cookie Mold
+2
Patterned Gingerbread House Cookie Cutter Molds Mini Christmas 3D Plastic DIY Baking Tools Holiday Decor
-4%
$0.80-4.12
Mix MOQ : 2
Free Shipping
Christmas Mini Ring Cookie Cutter Cartoon Gingerbread Man Santa Reindeer Tree DIY Baking Tool PLA Plastic Festive Decor
Christmas Mini Ring Cookie Cutter Cartoon Gingerbread Man Santa Reindeer Tree DIY Baking Tool PLA Plastic Festive Decor
like
Find Similar
Mini ring cookie cutter in white plastic for DIY Christmas baking and festive treats - E404 Christmas Wreath 10cm
11-piece white plastic Christmas cookie cutter set including gingerbread man and snowman - W089 Mini Ring 10-Piece Set
White circular Christmas cookie ring mold in durable plastic for DIY holiday baking - Children's Ring Circle
Mini Christmas cookie cutter circular mold in white plastic for festive baking - Adult's Ring Circle
Christmas Mini Ring Cookie Cutter Cartoon Gingerbread Man Santa Reindeer Tree DIY Baking Tool PLA Plastic Festive Decor
$0.72-6.08
Mix MOQ : 2
Free Shipping
5D Embossed Christmas Nail Art Stickers White Reindeer Snowflake Christmas Tree Self Adhesive Decals Winter Holiday DIY Manicure
5D Embossed Christmas Nail Art Stickers White Reindeer Snowflake Christmas Tree Self Adhesive Decals Winter Holiday DIY Manicure
like
Find Similar
3D embossed Christmas nail art stickers TS-237 with silver snowflake and reindeer motifs - TS-237 Christmas Elk Embossed Style / White/Silver
5D Embossed Christmas Nail Art Stickers White Reindeer Snowflake Christmas Tree Self Adhesive Decals Winter Holiday DIY Manicure
$1.30
No MOQ
Free Shipping
Christmas Window Stickers PVC Static Film Santa Reindeer Tree Snowflakes Removable Reusable Festive Home Decor Decals
Christmas Window Stickers PVC Static Film Santa Reindeer Tree Snowflakes Removable Reusable Festive Home Decor Decals
like
Find Similar
1 option
Christmas Window Stickers PVC Static Film Santa Reindeer Tree Snowflakes Removable Reusable Festive Home Decor Decals
$1.21
Mix MOQ : 2
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access