Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Christmas Tinplate Coin Purse Mini Earphone Case Zippered Hard Shell Round Square Cartoon Santa Gift Storage Bag
Christmas Tinplate Coin Purse Mini Earphone Case Zippered Hard Shell Round Square Cartoon Santa Gift Storage Bag
like
Find Similar
Christmas round tinplate coin purse featuring cartoon Santa and reindeer patterns - Christmas Style (Round)
Christmas tinplate mini coin purses with festive Santa and reindeer designs and zippers - Christmas Style (Square)
Christmas Tinplate Coin Purse Mini Earphone Case Zippered Hard Shell Round Square Cartoon Santa Gift Storage Bag
-5%
$0.35-0.41
Mix MOQ : 2
 · 
1 reviews
Christmas Postage Stamp Style Sealing Stickers Rectangular Holiday Gift Wrapping Decorative Adhesive Labels Festive Pattern
Christmas Postage Stamp Style Sealing Stickers Rectangular Holiday Gift Wrapping Decorative Adhesive Labels Festive Pattern
like
Find Similar
1 option
Christmas Postage Stamp Style Sealing Stickers Rectangular Holiday Gift Wrapping Decorative Adhesive Labels Festive Pattern
$0.09
No MOQ
 · 
10 views
Christmas Window Stickers PVC Santa Claus Reindeer Snowflake Decals For Glass Shop Holiday Home Decoration Cartoon Festive
Christmas Window Stickers PVC Santa Claus Reindeer Snowflake Decals For Glass Shop Holiday Home Decoration Cartoon Festive
like
Find Similar
1 option
Christmas Window Stickers PVC Santa Claus Reindeer Snowflake Decals For Glass Shop Holiday Home Decoration Cartoon Festive
$1.38
Mix MOQ : 2
Christmas Window Stickers Gold Brushed PVC Static Cling Snowflake Star Hanging Ornament Glass Door Decals Festive Shop Home Decor
Christmas Window Stickers Gold Brushed PVC Static Cling Snowflake Star Hanging Ornament Glass Door Decals Festive Shop Home Decor
like
Find Similar
Golden Christmas snowflake and star window stickers for festive glass display decoration - Gold
Christmas Window Stickers Gold Brushed PVC Static Cling Snowflake Star Hanging Ornament Glass Door Decals Festive Shop Home Decor
$4.84
Mix MOQ : 2
Christmas Wreath Artificial Pine Needle Garland With LED Lights Ornaments For Front Door Wall Window Festive Decor
Christmas Wreath Artificial Pine Needle Garland With LED Lights Ornaments For Front Door Wall Window Festive Decor
like
Find Similar
Christmas wreath featuring a plush reindeer with festive red scarf and snowy pine branches - Small Branch Wreath Reindeer
Christmas wreath with natural vines, cotton, and rustic wooden pendants for door decor - Cotton Style
Christmas wreath with pine needles, red berries and flowers, 32cm diameter size - Three Red Flowers Style
Handmade Christmas wreath with pink swan ornament, pine needles, berries and red ribbon - Swan Style
+15
Christmas Wreath Artificial Pine Needle Garland With LED Lights Ornaments For Front Door Wall Window Festive Decor
-5%
$3.15-9.59
Mix MOQ : 2
 · 
11 views
Christmas LED Hanging Lights Acrylic PVC Laser Engraved Window Suction Cup Lamp Warm White Festive Holiday Home Decor
Christmas LED Hanging Lights Acrylic PVC Laser Engraved Window Suction Cup Lamp Warm White Festive Holiday Home Decor
like
Find Similar
4 options
Christmas LED Hanging Lights Acrylic PVC Laser Engraved Window Suction Cup Lamp Warm White Festive Holiday Home Decor
$6.34
No MOQ
Christmas Window Stickers PVC Static Cling Santa Claus Reindeer Snowflakes Decals For Glass Door Shop Home Festive Decor
Christmas Window Stickers PVC Static Cling Santa Claus Reindeer Snowflakes Decals For Glass Door Shop Home Festive Decor
like
Find Similar
Detailed dimension layout for Christmas stickers featuring Santa, reindeer and snowflakes - Christmas Color Static Sticker XC008
Christmas window stickers featuring Santa, reindeer, and snowflakes with size dimensions - Christmas Color Static Sticker XC009
Christmas static window stickers featuring Santa Claus and snowman patterns on blue backing - Colored Christmas Static Sticker BQ027
White Christmas snowflake window clings dimensions chart 19.6x29.5cm for party decor - Snowflake Static Sticker BQ013
+11
Christmas Window Stickers PVC Static Cling Santa Claus Reindeer Snowflakes Decals For Glass Door Shop Home Festive Decor
-5%
$0.49-2.55
Mix MOQ : 2
Acrylic Christmas Cake Toppers Printed Reindeer Santa Hat Merry Christmas Holiday Dessert Party Decorations
Acrylic Christmas Cake Toppers Printed Reindeer Santa Hat Merry Christmas Holiday Dessert Party Decorations
like
Find Similar
Acrylic Merry Christmas cake topper with reindeer and festive motifs on green background - Clear Base Style A
Acrylic Santa Claus Merry Christmas cake topper ornament 10.3cm high for holiday decoration - Clear Base Style B
10CM Merry Christmas acrylic cake topper with reindeer antlers and festive hat - White Base Style A
Close-up of 12cm acrylic Merry Christmas cake topper with reindeer and holiday icons - White Base Style B
+7
Acrylic Christmas Cake Toppers Printed Reindeer Santa Hat Merry Christmas Holiday Dessert Party Decorations
$0.52
Mix MOQ : 2
Christmas Asymmetric Earrings Alloy Enamel Santa Reindeer Tree With 925 Sterling Silver Earring Post Festive Jewelry Women
Christmas Asymmetric Earrings Alloy Enamel Santa Reindeer Tree With 925 Sterling Silver Earring Post Festive Jewelry Women
like
Find Similar
Detailed close-up of asymmetric Christmas stud earrings with deer and festive wreath - 1# Reindeer & Wreath
Detailed shot of Christmas candy cane and wreath earrings on 925 silver posts - 2# Candy Cane & Wreath
Detail of Christmas wreath and snowflake earrings with rhinestones on 925 silver posts - 3# Snowflake & Wreath
Close-up of asymmetric Christmas bell and tree earrings with 925 silver posts on white card - 4# Bell & Christmas Tree
+9
Christmas Asymmetric Earrings Alloy Enamel Santa Reindeer Tree With 925 Sterling Silver Earring Post Festive Jewelry Women
-4%
$1.00
No MOQ
Free Shipping
Christmas Window Stickers Static PVC Snowflake Santa Claus Reindeer Decals For Glass Holiday Party Home Decor
Christmas Window Stickers Static PVC Snowflake Santa Claus Reindeer Decals For Glass Holiday Party Home Decor
like
Find Similar
Christmas snowman and snowflake window stickers with detailed dimensions, model BQ001 - Colorful Static Sticker BQ001
Christmas window decals with Santa Claus and snowflakes layout dimensions 29.5x19.6cm - Colorful Static Sticker BQ002
Christmas window static stickers featuring Santa reindeer and snowflakes model BQ003 - Colorful Static Sticker BQ003
Christmas snowman window static stickers BQ004 with snowflakes and sizing details - Colorful Static Sticker BQ004
+35
Christmas Window Stickers Static PVC Snowflake Santa Claus Reindeer Decals For Glass Holiday Party Home Decor
-16%
$0.05-1.53
Mix MOQ : 2
Free Shipping
Christmas Window Stickers Static Cling PVC Santa Reindeer Snowflakes Decals For Glass Holiday Party Home Decoration
Christmas Window Stickers Static Cling PVC Santa Reindeer Snowflakes Decals For Glass Holiday Party Home Decoration
like
Find Similar
Christmas snowman and snowflake window stickers with detailed dimensions, model BQ001 - Colorful Static Sticker BQ001
Christmas window decals with Santa Claus and snowflakes layout dimensions 29.5x19.6cm - Colorful Static Sticker BQ002
Christmas window static stickers featuring Santa reindeer and snowflakes model BQ003 - Colorful Static Sticker BQ003
Christmas snowman window static stickers BQ004 with snowflakes and sizing details - Colorful Static Sticker BQ004
+31
Christmas Window Stickers Static Cling PVC Santa Reindeer Snowflakes Decals For Glass Holiday Party Home Decoration
$0.26-1.70
Mix MOQ : 2
Lighted Christmas Wooden Snowflake Hanging Ornaments Laser Cut Wood Holiday Decoration With LED Warm Glow
Lighted Christmas Wooden Snowflake Hanging Ornaments Laser Cut Wood Holiday Decoration With LED Warm Glow
like
Find Similar
Wooden Christmas snowflake hanging ornament with house design and red wooden bead - Style 1
Luminous snowflake wooden Christmas ornament with tree carving and red bead detail - Style 2
Luminous wooden snowflake Christmas ornament with hollow snowman and house carving - Style 3
Wooden Christmas snowflake ornament with snowman and tree motifs in natural finish - Style 4
+3
Lighted Christmas Wooden Snowflake Hanging Ornaments Laser Cut Wood Holiday Decoration With LED Warm Glow
$1.15
Mix MOQ : 50
Christmas Tree Skirt Round Short Plush Fabric Red Piping Cartoon Prints Nordic Style Holiday Party Home Floor Decor
Christmas Tree Skirt Round Short Plush Fabric Red Piping Cartoon Prints Nordic Style Holiday Party Home Floor Decor
like
Find Similar
1 option
Christmas Tree Skirt Round Short Plush Fabric Red Piping Cartoon Prints Nordic Style Holiday Party Home Floor Decor
-4%
$7.12
No MOQ
Christmas Wooden Car Hanging Pendants Colorful Cartoon Vehicle Ornaments For Xmas Tree Holiday Party Decor Craft Gifts
Christmas Wooden Car Hanging Pendants Colorful Cartoon Vehicle Ornaments For Xmas Tree Holiday Party Decor Craft Gifts
like
Find Similar
Three-piece set of wooden Christmas ornaments featuring red trucks with Peace and Joy text - O-FJ89 Letter Car Hanging Ornaments (Set of 3)
Christmas Wooden Car Hanging Pendants Colorful Cartoon Vehicle Ornaments For Xmas Tree Holiday Party Decor Craft Gifts
-5%
$1.32
No MOQ
Christmas Sticker Labels Kraft Paper Advent Calendar Countdown Decals For DIY Gift Wrapping Scrapbooking Party Decor
Christmas Sticker Labels Kraft Paper Advent Calendar Countdown Decals For DIY Gift Wrapping Scrapbooking Party Decor
like
Find Similar
Christmas snowflake stickers on kraft paper measuring 13.5x10.5cm for holiday DIY decor - T7725 Snowflake Stickers
Christmas stickers set with Jolly Season greetings and precise size dimensions - T7713 Merry Christmas
Christmas advent calendar stickers with numbered 1-24 labels on gray wood background - T7724 Countdown 1-24 2Sheets
Christmas cartoon stickers sheet featuring Santa motifs with dimensions and weight info - T7726 Christmas Stickers
+4
Christmas Sticker Labels Kraft Paper Advent Calendar Countdown Decals For DIY Gift Wrapping Scrapbooking Party Decor
$0.07-0.14
Mix MOQ : 2
 · 
73 sold recently
Christmas Wooden Hanging Ornaments Painted Wood Reindeer Tree Star Pendants For Holiday Home Window Decoration
Christmas Wooden Hanging Ornaments Painted Wood Reindeer Tree Star Pendants For Holiday Home Window Decoration
like
Find Similar
6 options
Christmas Wooden Hanging Ornaments Painted Wood Reindeer Tree Star Pendants For Holiday Home Window Decoration
$2.45
No MOQ
Christmas Pillowcase Linen Square Cushion Cover For Sofa Holiday Home Decor Festive Reindeer Snowflake Pattern Decorative
Christmas Pillowcase Linen Square Cushion Cover For Sofa Holiday Home Decor Festive Reindeer Snowflake Pattern Decorative
like
Find Similar
Detail of Christmas linen pillowcase featuring reindeer patterns and Merry Christmas text - Christmas Elements Notes (YMD9-1)
Detailed texture of linen pillowcase with golden reindeer and Christmas holiday patterns - Golden Running Reindeer (YMD9-2)
Detail of Christmas linen pillowcase showing festive gold baubles and holiday text - Colorful Christmas Baubles (YMD9-3)
Detail of linen pillow cover with festive 'Be Merry & Bright' lettering and stars - Be Merry and Bright Style (YMD9-4)
+6
Christmas Pillowcase Linen Square Cushion Cover For Sofa Holiday Home Decor Festive Reindeer Snowflake Pattern Decorative
-5%
$1.20
Mix MOQ : 2
Christmas Ball Ornaments Festive Foam Hanging Baubles With Ribbon And Gift Box For Holiday Tree Decor Santa Reindeer Pattern
Christmas Ball Ornaments Festive Foam Hanging Baubles With Ribbon And Gift Box For Holiday Tree Decor Santa Reindeer Pattern
like
Find Similar
14-piece red and white cartoon painted Christmas tree ornaments set with 7.2cm foam balls - Style A03 (14Pcs Box)/Red White Tree Pattern
14pcs red and white Christmas foam ball ornaments in a green polka dot hexagon box - Car Style / 14Pcs
Set of 14 red and white Christmas balls with tree pattern and gift box for decor - Christmas Tree Style / 14Pcs
Christmas Ball Ornaments Festive Foam Hanging Baubles With Ribbon And Gift Box For Holiday Tree Decor Santa Reindeer Pattern
$17.23
No MOQ
Paper Christmas Wreath Pendant Glitter Cardboard Hanging Decor For Holiday Party Home Door Wall Santa Reindeer House
Paper Christmas Wreath Pendant Glitter Cardboard Hanging Decor For Holiday Party Home Door Wall Santa Reindeer House
like
Find Similar
36cm 3D paper Christmas wreath with Santa, reindeer and glitter Merry Christmas banner - 36cm Santa Claus Style
40cm 3D paper Christmas wreath with red bow and Merry Christmas sign decoration - 40cm Bowknot Style
50cm horizontal Christmas vine garland with red sequin bow and festive ornaments - 50cm Horizontal Garland
Paper Christmas Wreath Pendant Glitter Cardboard Hanging Decor For Holiday Party Home Door Wall Santa Reindeer House
$1.59
No MOQ
Christmas Wall Window Stickers Santa Claus Reindeer PVC Waterproof Decals Shop Home Holiday Party Decoration Merry Xmas
Christmas Wall Window Stickers Santa Claus Reindeer PVC Waterproof Decals Shop Home Holiday Party Decoration Merry Xmas
like
Find Similar
1 option
Christmas Wall Window Stickers Santa Claus Reindeer PVC Waterproof Decals Shop Home Holiday Party Decoration Merry Xmas
$0.66
No MOQ
Christmas Window Stickers PVC Static Cling Removable Wall Decals Reindeer Santa Snowflakes For Shop Home Glass Decor
Christmas Window Stickers PVC Static Cling Removable Wall Decals Reindeer Santa Snowflakes For Shop Home Glass Decor
like
Find Similar
1 option
Christmas Window Stickers PVC Static Cling Removable Wall Decals Reindeer Santa Snowflakes For Shop Home Glass Decor
-4%
$1.37
No MOQ
Christmas Ball Ornaments Assorted Holiday Tree Decorations Glitter Glossy Plastic Baubles For Festive Atmosphere
Christmas Ball Ornaments Assorted Holiday Tree Decorations Glitter Glossy Plastic Baubles For Festive Atmosphere
like
Find Similar
2 options
Christmas Ball Ornaments Assorted Holiday Tree Decorations Glitter Glossy Plastic Baubles For Festive Atmosphere
$4.76
No MOQ
Christmas Wooden House Hanging Ornaments Hemp Rope Pine Needle Pine Cone Handmade Festive Wall Decor Painted Pendants
Christmas Wooden House Hanging Ornaments Hemp Rope Pine Needle Pine Cone Handmade Festive Wall Decor Painted Pendants
like
Find Similar
Creative wooden Christmas tree house ornament with reindeer, pine cones and rustic rope - Reindeer Style Wooden House Hanging
Christmas Wooden House Hanging Ornaments Hemp Rope Pine Needle Pine Cone Handmade Festive Wall Decor Painted Pendants
$1.33
No MOQ
Christmas Sealing Stickers Self Adhesive Gift Packaging Labels Merry Christmas Patterns For Envelope Boxes Holiday Decor
Christmas Sealing Stickers Self Adhesive Gift Packaging Labels Merry Christmas Patterns For Envelope Boxes Holiday Decor
like
Find Similar
Red and green Christmas gift seal stickers with Merry Christmas greeting in round badge style - TZ45 [8 Stickers/Sheet]
Christmas tree gift seal stickers in red and green colors, 12 pieces per sheet with stars - TZ31 [12 Stickers/Sheet]
Christmas gift seal stickers with Santa, snowman, and reindeer patterns in 3x5 grid TZ50 - TZ50 [15 Stickers/Sheet]
Christmas Sealing Stickers Self Adhesive Gift Packaging Labels Merry Christmas Patterns For Envelope Boxes Holiday Decor
$0.09
Mix MOQ : 3
Christmas Round Stickers Coated Paper Sealing Labels For Gift Box Food Packaging Festive Tree Cartoon Patterns Holiday Decoration
Christmas Round Stickers Coated Paper Sealing Labels For Gift Box Food Packaging Festive Tree Cartoon Patterns Holiday Decoration
like
Find Similar
Set of circular Christmas gift box stickers with merry christmas text in various colors - Christmas Tree
Red and white Christmas gift box stickers with Merry Christmas typography and snowflakes - Christmas English Text
Christmas Round Stickers Coated Paper Sealing Labels For Gift Box Food Packaging Festive Tree Cartoon Patterns Holiday Decoration
-9%
$0.09
No MOQ
Christmas Window Stickers PVC Waterproof Removable Crystal Ball Hanging Bells Decals Festival Party Decoration For Shop Home
Christmas Window Stickers PVC Waterproof Removable Crystal Ball Hanging Bells Decals Festival Party Decoration For Shop Home
like
Find Similar
1 option
Christmas Window Stickers PVC Waterproof Removable Crystal Ball Hanging Bells Decals Festival Party Decoration For Shop Home
$0.86
No MOQ
DIY Felt Christmas Tree And Removable Ornaments Wall Hanging Xmas Decorations Handicraft Gifts For Kids Toddlers
DIY Felt Christmas Tree And Removable Ornaments Wall Hanging Xmas Decorations Handicraft Gifts For Kids Toddlers
like
Find Similar
2 options
DIY Felt Christmas Tree And Removable Ornaments Wall Hanging Xmas Decorations Handicraft Gifts For Kids Toddlers
$5.19-5.48
No MOQ
Christmas Ball Ornament Foam Painted Cartoon Santa Reindeer Pattern Tree Hanging Decor Festive Ribbon Bow
Christmas Ball Ornament Foam Painted Cartoon Santa Reindeer Pattern Tree Hanging Decor Festive Ribbon Bow
like
Find Similar
Light blue 7.2cm Christmas foam ball with Santa and penguin prints and red ribbon - Blue
Christmas Ball Ornament Foam Painted Cartoon Santa Reindeer Pattern Tree Hanging Decor Festive Ribbon Bow
$1.30
No MOQ
Crystal Snow Globe Music Box Resin Glass Glowing LED Light Musical Ornament For Home Decor Gift Carousel Astronaut Character
Crystal Snow Globe Music Box Resin Glass Glowing LED Light Musical Ornament For Home Decor Gift Carousel Astronaut Character
like
Find Similar
Astronaut crystal ball music box with colorful lights and snow, featuring My Dream base - Astronaut-MY DREAM / Green
Purple carousel snow globe music box with flying unicorns and Happy Time base - Carousel-Happy Time / Purple
Carousel crystal ball music box with bear chef and cupcake base for Christmas gift - Bear Chef-Donut / Pink
Carousel music box with cake bear glass globe and cupcake base for home decor - Bear Chef Style / K017-Coffee
+24
Crystal Snow Globe Music Box Resin Glass Glowing LED Light Musical Ornament For Home Decor Gift Carousel Astronaut Character
-5%
$4.61-5.65
No MOQ
 · 
10 views
Christmas Hanging Ornaments Natural Wood DIY Crafts Holiday Party Home Decorations Rustic Style
Christmas Hanging Ornaments Natural Wood DIY Crafts Holiday Party Home Decorations Rustic Style
like
Find Similar
6 options
Christmas Hanging Ornaments Natural Wood DIY Crafts Holiday Party Home Decorations Rustic Style
$1.01
No MOQ
Christmas Tree Hanging Pendant Wood Cartoon Mask Family Design Love And Peace Festive Holiday Party Home Decor Ornament
Christmas Tree Hanging Pendant Wood Cartoon Mask Family Design Love And Peace Festive Holiday Party Home Decor Ornament
like
Find Similar
Wooden 2020 Christmas ornament with masked figures and Love and Peace message - 3 Heads
2021 pandemic snowman wooden Christmas ornament with Love and Peace lettering - 2 Heads
2021 wooden Christmas tree ornament featuring masked family with Love and Peace text - 4 Heads
2022 family of six wood Christmas ornament with masked snowmen and love and peace text - 6 Heads
+1
Christmas Tree Hanging Pendant Wood Cartoon Mask Family Design Love And Peace Festive Holiday Party Home Decor Ornament
$0.58-0.63
No MOQ
Free Shipping
Christmas Pendant Necklace Alloy Enamel Rhinestone Snowflake Santa Reindeer Tree Bell Jewelry Holiday Gift Women Girls
Christmas Pendant Necklace Alloy Enamel Rhinestone Snowflake Santa Reindeer Tree Bell Jewelry Holiday Gift Women Girls
like
Find Similar
Christmas jewelry set with red and white enamel bell necklace and green bow pendant - Christmas Bells A
Christmas stocking necklace and earring set with red enamel and gold chain detailing - Christmas Sock A
Golden Christmas necklace with Santa Claus enamel pendant on white background - Santa Claus
Christmas necklace with red snowflake bell pendant and white bead on golden chain - Mushroom
+5
Christmas Pendant Necklace Alloy Enamel Rhinestone Snowflake Santa Reindeer Tree Bell Jewelry Holiday Gift Women Girls
$0.92-1.02
No MOQ
Free Shipping
Christmas Pendants Charms For DIY Jewelry Making Gold Plated Metal Enamel Reindeer Snowflake Xmas Tree Gingerbread Man
Christmas Pendants Charms For DIY Jewelry Making Gold Plated Metal Enamel Reindeer Snowflake Xmas Tree Gingerbread Man
like
Find Similar
Detailed view of 18K gold-plated Christmas candy cane pendant with dimensions and weight - Candy Cane Style (Style 4)
Golden Christmas tree pendant with green rhinestones and 2.2g weight measurement labels - Rhinestone Christmas Tree Style (Style 9)
Christmas Pendants Charms For DIY Jewelry Making Gold Plated Metal Enamel Reindeer Snowflake Xmas Tree Gingerbread Man
$0.74
No MOQ
Free Shipping
Christmas Layered Bracelet Stainless Steel Enamel Pendants Imitation Artificial Pearl Festive Santa Reindeer Women Jewelry
Christmas Layered Bracelet Stainless Steel Enamel Pendants Imitation Artificial Pearl Festive Santa Reindeer Women Jewelry
like
Find Similar
Gold double-layer Christmas bracelet with pearl beads and gingerbread man pendants - Gingerbread Man Tree Style (KB207741-ZLA)
Gold-plated double-layer bracelet with Christmas hat, bell, and sock pendants with pearls - Christmas Hat Bell Style (KB207742-ZLA)
Golden stainless steel double-layer Christmas bracelet with reindeer and candy cane charms - Reindeer Candy Cane Style (KB207744-ZLA)
Double-layer gold bracelet with white pearls and reindeer and Christmas tree charms - Christmas Tree Fawn Style (KB207745-ZLA)
+4
Christmas Layered Bracelet Stainless Steel Enamel Pendants Imitation Artificial Pearl Festive Santa Reindeer Women Jewelry
$2.53
No MOQ
Free Shipping
Christmas Tree Hanging Ornaments Glitter Acrylic Wood Snowflakes Angel Reindeer Bow Festive Holiday Party Decor
Christmas Tree Hanging Ornaments Glitter Acrylic Wood Snowflakes Angel Reindeer Bow Festive Holiday Party Decor
like
Find Similar
Sparkling silver JOY sign Christmas ornament with white ribbon hanging on a tree branch - Silver Glitter JOY-A
Silver glitter bow Christmas ornament with white hanging string, 8x9cm festive hanging decor - Silver Glitter Bow-A
Sparkling silver Christmas tree hanging ornament with glitter finish, size 7.5x10cm - Silver White Glitter Tree-A
Silver glitter star Christmas ornament with cutout center and white ribbon hanger - Silver Glitter Star-A
+50
Christmas Tree Hanging Ornaments Glitter Acrylic Wood Snowflakes Angel Reindeer Bow Festive Holiday Party Decor
$0.56-2.59
No MOQ
 · 
16 sold recently
Free Shipping
Christmas Tree Collar Non-woven Fabric Folding Base Surround Festive Santa Claus Buffalo Plaid Holiday Decoration
Christmas Tree Collar Non-woven Fabric Folding Base Surround Festive Santa Claus Buffalo Plaid Holiday Decoration
like
Find Similar
Red Christmas tree collar with cartoon reindeer and Santa claus hexagonal design - Style 01 (Red/Cartoon Santa Reindeer)
Red buffalo plaid Christmas tree collar with Merry Christmas gold print and hexagons - Style 02 (Red Black Plaid/Golden Pine)
Red and black checkered Christmas tree skirt with Santa and snowman patterns - Style 03 (Red Black Plaid/Santa Snowman)
Red Christmas tree collar with Merry Christmas prints of Santa Claus and snowmen - Style 04 (Solid Red/Santa Snowman)
+2
Christmas Tree Collar Non-woven Fabric Folding Base Surround Festive Santa Claus Buffalo Plaid Holiday Decoration
-5%
$7.39
No MOQ
Festive Holiday Party Glasses Frame Paper Cardboard Holiday Photo Booth Props For Christmas Halloween Graduation Independence Day
Festive Holiday Party Glasses Frame Paper Cardboard Holiday Photo Booth Props For Christmas Halloween Graduation Independence Day
like
Find Similar
Set of 8 paper party glasses for US Independence Day with red, white, and blue designs - Independence Day
Set of 8 black and gold glitter graduation party paper glasses with festive graduation motifs - Graduation
Set of 8 Halloween paper party glasses featuring pumpkin, ghost, and bat designs - Halloween Glasses Set
Set of 8 festive Christmas paper glasses featuring snowman, reindeer, and Santa Claus designs - Christmas
Festive Holiday Party Glasses Frame Paper Cardboard Holiday Photo Booth Props For Christmas Halloween Graduation Independence Day
-5%
$1.26-1.34
No MOQ
Christmas Tree Ornaments Painted Plastic Baubles Stars Figurines Colorful Electroplated Festive Holiday Decor Hanging
Christmas Tree Ornaments Painted Plastic Baubles Stars Figurines Colorful Electroplated Festive Holiday Decor Hanging
like
Find Similar
12pcs blue and gold 8cm Christmas ball ornaments with snowflake patterns. - Blue & Gold Style (ZH059-7)
12-piece set of 8cm green and red Christmas ornaments with gold relief patterns - Wine Red & Dark Green Gold Style (ZH059-6)
Set of 12 red and gold 8cm Christmas ball ornaments with unique embossed patterns - Red & Gold Style (ZH059-2)
12-piece white and gold Christmas ornament set with diverse relief patterns and sizes - White & Gold Style (ZH059-3)
+5
Christmas Tree Ornaments Painted Plastic Baubles Stars Figurines Colorful Electroplated Festive Holiday Decor Hanging
$9.08
No MOQ
Christmas Snow Globe Lantern Vintage Bronze LED Light Swirling Glitter Musical Holiday Decoration Ornament
Christmas Snow Globe Lantern Vintage Bronze LED Light Swirling Glitter Musical Holiday Decoration Ornament
like
Find Similar
Bronze Christmas lantern with reindeer, snowy interior and festive LED lighting effects - Medium Square Lantern Reindeer and Tree
Christmas Snow Globe Lantern Vintage Bronze LED Light Swirling Glitter Musical Holiday Decoration Ornament
$9.22
Mix MOQ : 2
 · 
26 views
Christmas Beaded Bracelet Multi Layer Polymer Clay Alloy Enamel Santa Reindeer Pendants Letter Beads Festive Jewelry
Christmas Beaded Bracelet Multi Layer Polymer Clay Alloy Enamel Santa Reindeer Pendants Letter Beads Festive Jewelry
like
Find Similar
Detail of Christmas beaded bracelet with red green crystals, tree and bell charms - D1134 (Bell + Christmas Tree)
Christmas beaded bracelet set with red and green crystal beads, bells and Santa charms - D1135 (Santa + Snowman)
Christmas beaded bracelet set with Merry Christmas pendants and bells in red green gold - D1150 (Blessing Plate + Lucky Bag)
Christmas beaded bracelets set featuring reindeer and snowman charms with bells - D1137 (Reindeer + Snowman)
+16
Christmas Beaded Bracelet Multi Layer Polymer Clay Alloy Enamel Santa Reindeer Pendants Letter Beads Festive Jewelry
-12%
$0.35-3.00
No MOQ
 · 
146 sold recently
Free Shipping
Christmas Beaded Bracelets Wood Plastic Beads Alloy Enamel Charms Festive Holiday Tree Santa Reindeer Snowflakes Novelty
Christmas Beaded Bracelets Wood Plastic Beads Alloy Enamel Charms Festive Holiday Tree Santa Reindeer Snowflakes Novelty
like
Find Similar
Christmas charm bracelet set featuring reindeer, snowflakes and festive beads - Christmas Theme Set SY0885-1
Beaded Christmas bracelet set with festive snowflake, reindeer and Santa charms - Christmas Theme Set SY0886-1
Christmas Beaded Bracelets Wood Plastic Beads Alloy Enamel Charms Festive Holiday Tree Santa Reindeer Snowflakes Novelty
$1.81
Mix MOQ : 2
 · 
10 views
Christmas Charm Bracelet Alloy Enamel Santa Claus Reindeer Snowflake Bell Pendants Adjustable Holiday Jewelry Festive Gift
Christmas Charm Bracelet Alloy Enamel Santa Claus Reindeer Snowflake Bell Pendants Adjustable Holiday Jewelry Festive Gift
like
Find Similar
Detailed overhead shot of Christmas charm bracelet with Santa, tree, and snowflake pendants - D1238
Christmas charm bracelet with Santa hat, bells, and snowflakes on a festive red base - D1239
Detailed shot of Christmas charm bracelet with snowman, tree and bells on red festive stand - D1240
Detailed view of Christmas charm bracelet with Santa and Reindeer pendants on red stand - D1241
+12
Christmas Charm Bracelet Alloy Enamel Santa Claus Reindeer Snowflake Bell Pendants Adjustable Holiday Jewelry Festive Gift
$0.92
No MOQ
 · 
101 sold recently
Christmas Earrings Alloy Enamel Rhinestone Reindeer Tree Santa Snowflake Gingerbread Man Dangle Jewelry For Women
Christmas Earrings Alloy Enamel Rhinestone Reindeer Tree Santa Snowflake Gingerbread Man Dangle Jewelry For Women
like
Find Similar
Sparkling pink rhinestone Christmas tree earrings in gold finish, size 4.3cm by 2.4cm - Pink and Gold Rhinestone Christmas Tree-SD61310
Pink Christmas tree earrings with golden bow and dots, measures 5.0cm by 3.2cm - Pink Polka Dot Bow Christmas Tree-SD61330
Christmas tree alloy earrings with green enamel and white bow in 5.3cm length - Green Enamel Colorful Rhinestone Christmas Tree-SD61318
Festive green enamel Christmas tree drop earrings with 4.2cm length and 1.4cm width - Green Snow-covered Christmas Tree Hooks-SD61305
+35
Christmas Earrings Alloy Enamel Rhinestone Reindeer Tree Santa Snowflake Gingerbread Man Dangle Jewelry For Women
$0.28-2.75
No MOQ
 · 
1K+ sold recently
Top 5% Best Sellers
in Earrings
Free Shipping
Christmas Glasses Frames Glitter Reindeer Antlers Santa Hat Elf Ears Festive Holiday Party Decoration Photo Props Adults Kids
Christmas Glasses Frames Glitter Reindeer Antlers Santa Hat Elf Ears Festive Holiday Party Decoration Photo Props Adults Kids
like
Find Similar
Christmas reindeer glasses frame with red plaid antlers and dimensions 19x13cm - Gold Frame Red Long Antlers
Christmas reindeer glasses frame with green glitter antlers and size dimensions - Gold Frame Green Long Antlers
Glittery gold Christmas reindeer glasses frame with red antlers for party decoration - Gold Frame Red Antlers
Gold glitter reindeer Christmas glasses with holly leaves and 17cm width dimensions - Gold Frame Rose Gold Antlers
+8
Christmas Glasses Frames Glitter Reindeer Antlers Santa Hat Elf Ears Festive Holiday Party Decoration Photo Props Adults Kids
-5%
$0.40-0.80
Mix MOQ : 2
Christmas Women Crew Socks Cotton Blend Santa Reindeer Snowflake Pattern Winter Warm Holiday Gift Mid Calf Socks
Christmas Women Crew Socks Cotton Blend Santa Reindeer Snowflake Pattern Winter Warm Holiday Gift Mid Calf Socks
like
Find Similar
Red Christmas cotton socks with white reindeer pattern and knit texture finish - 37-44 / Red Reindeer
Festive dark green cotton blend crew socks with Christmas stockings and snowflakes - 37-44 / Christmas Sock & Candy
Christmas themed red cotton mid-calf socks with white snowflake patterns for women - 37-44 / Red with Snowflake
Bright blue Christmas crew socks featuring Santa Claus, reindeer, and festive tree patterns - 37-44 / Blue Santa Claus
+19
Christmas Women Crew Socks Cotton Blend Santa Reindeer Snowflake Pattern Winter Warm Holiday Gift Mid Calf Socks
$1.10
Mix MOQ : 20
 · 
15 views
Christmas Decorative Bows Plaid Faux Linen Flocking Golden Bells Berries For Tree Wreath Gift Box Holiday Home Decor
Christmas Decorative Bows Plaid Faux Linen Flocking Golden Bells Berries For Tree Wreath Gift Box Holiday Home Decor
like
Find Similar
Red and green plaid Christmas bow with golden bells and berries, 9.8cm height ornament - Style A
Christmas bow ornament in red and green tartan fabric with gold bells and berries - Style B
Christmas plaid ribbon bow with golden bell and leaves, dimensions 9.8cm x 8cm decoration - Style C
Christmas bow ornament with red and green plaid pattern and golden bells for tree decoration - Style D
+12
Christmas Decorative Bows Plaid Faux Linen Flocking Golden Bells Berries For Tree Wreath Gift Box Holiday Home Decor
$0.58
Mix MOQ : 2
Free Shipping
LED Light Up Christmas Village Houses White Ceramic Snowy Miniature Ornament With Gold Star For Holiday Desktop Decoration
LED Light Up Christmas Village Houses White Ceramic Snowy Miniature Ornament With Gold Star For Holiday Desktop Decoration
like
Find Similar
Ceramic Santa gnome LED figurine with star cutouts and warm glow for Christmas decor - Santa Claus
White ceramic house ornament with star cutouts and warm glowing light for Christmas - Ceramic House
White ceramic bell-shaped Christmas ornament with star cutouts and warm glowing light - Wind Bell
Ceramic Christmas tree night light with warm LED glow and star hollow cutout, 14cm tall - Christmas Tree
+19
LED Light Up Christmas Village Houses White Ceramic Snowy Miniature Ornament With Gold Star For Holiday Desktop Decoration
$4.32-9.22
No MOQ
 · 
12 views
Wooden Cookie Mold Cutter Embossed Beech Wood Biscuit Press DIY Baking 3D Flower Animal Pattern Gingerbread
Wooden Cookie Mold Cutter Embossed Beech Wood Biscuit Press DIY Baking 3D Flower Animal Pattern Gingerbread
like
Find Similar
Handcrafted beechwood cookie mold featuring a detailed hedgehog carving for baking - Hedgehog
Rectangular beech wood cookie mold featuring a detailed deep-carved rose flower pattern - Red Rose
Beech wood cookie mold with lily of the valley engraving and green finished pastry - Violet
Beech wood cookie mold with detailed reindeer carving and finished biscuit - Deer
+37
Wooden Cookie Mold Cutter Embossed Beech Wood Biscuit Press DIY Baking 3D Flower Animal Pattern Gingerbread
$3.17-4.90
Mix MOQ : 3
 · 
70 sold recently
Christmas Wine Bottle Stickers Merry Christmas Labels Festive Holiday Party Decor Adhesive Paper Decals For Beverage Bottles
Christmas Wine Bottle Stickers Merry Christmas Labels Festive Holiday Party Decor Adhesive Paper Decals For Beverage Bottles
like
Find Similar
Set of 8 festive Merry Christmas wine bottle stickers with cartoon holiday illustrations - Christmas Wine Bottle Stickers (L-00352)
Christmas Wine Bottle Stickers Merry Christmas Labels Festive Holiday Party Decor Adhesive Paper Decals For Beverage Bottles
-5%
$0.71
Mix MOQ : 3
Christmas Party Decoration Merry Christmas Banner Latex Balloons Paper Cake Toppers Spiral Hanging Swirls Holiday Decor
Christmas Party Decoration Merry Christmas Banner Latex Balloons Paper Cake Toppers Spiral Hanging Swirls Holiday Decor
like
Find Similar
Merry Christmas banner set with red and green pennants featuring snowflake and tree designs - Christmas Snowflake Banner
Merry Christmas colorful swirl hanging decorations with festive snowman and reindeer cutouts - Christmas 6Pcs Swirls
Christmas party balloon set with 14 red, green, and white latex balloons and gold sequins - 14-Piece Christmas Balloon Set
Christmas party cupcake topper set with 12 festive glitter designs and size chart - 12-Piece Christmas Cupcake Toppers
+6
Christmas Party Decoration Merry Christmas Banner Latex Balloons Paper Cake Toppers Spiral Hanging Swirls Holiday Decor
-5%
$0.55-4.24
Mix MOQ : 2
Free Shipping
Christmas Cake Topper Glitter Paper Cupcake Picks Reindeer Gingerbread Man Holiday Party Decoration Cartoon Style
Christmas Cake Topper Glitter Paper Cupcake Picks Reindeer Gingerbread Man Holiday Party Decoration Cartoon Style
like
Find Similar
Christmas party cupcake topper set with 12 festive glitter designs and size chart - Set of 12 Small Toppers
Sparkly green Merry Christmas cake topper with reindeer design and 15cm width dimensions - 1 Pack Large Topper
Christmas Cake Topper Glitter Paper Cupcake Picks Reindeer Gingerbread Man Holiday Party Decoration Cartoon Style
$0.58-0.72
Mix MOQ : 2
Christmas Hanging Ornament Acrylic Round Pendant Tree Decoration New Home Engagement Retirement Commemorative Decor
Christmas Hanging Ornament Acrylic Round Pendant Tree Decoration New Home Engagement Retirement Commemorative Decor
like
Find Similar
Acrylic Christmas ornament featuring Santa Claus and Merry Christmas text on white background - Style 1/Santa Claus
Round ceramic 2023 Christmas ornament with floral wreath and gold hanging chain - Style 2/2023 Wreath
Our First Christmas 2023 Mr. & Mrs. round ceramic ornament with golden hanging cord - Style 3/Mr & Mrs Wedding
Detail of round ceramic ornament with First Christmas Retired 2023 watercolor design - Style 4/Retired 2023
+1
Christmas Hanging Ornament Acrylic Round Pendant Tree Decoration New Home Engagement Retirement Commemorative Decor
$0.37
No MOQ
Christmas Wreath Door Hanging Festive Decoration With Artificial Pine Needles Red Velvet Bow Golden Bells Berries
Christmas Wreath Door Hanging Festive Decoration With Artificial Pine Needles Red Velvet Bow Golden Bells Berries
like
Find Similar
Detail of Christmas wreath with snowy pine needles, red berries, and natural pine cones - Three White Berries Style
Christmas wreath with red velvet bow, golden bells and Merry Christmas sign on white background - Gift Box Style H003-30CM
Artificial Christmas wreath with red bows, gold poinsettias and Merry Christmas sign - Four Flowers Style H002-30CM
Green Christmas wreath with golden bells, stars, and red gift boxes for holiday door decor - Golden Explosion Style-30CM
+13
Christmas Wreath Door Hanging Festive Decoration With Artificial Pine Needles Red Velvet Bow Golden Bells Berries
$3.17-7.49
No MOQ
Christmas Scratch Art Paper Ornaments Kit Rainbow DIY Hanging Decorations With Wooden Sticks And Ribbons For Kids Party Favors
Christmas Scratch Art Paper Ornaments Kit Rainbow DIY Hanging Decorations With Wooden Sticks And Ribbons For Kids Party Favors
like
Find Similar
24-piece Christmas DIY scratch art tags set with wooden styluses and colorful ribbons - Style 1
DIY Christmas scratch art kit with 24 ornaments 6 wooden styluses and colorful ribbons - Style 2
DIY Christmas scratch art set with 12 black ornaments, 6 wooden styluses and colorful ribbons - Gingerbread Man
DIY Christmas scratch art kit with 24 black silhouette tags, 6 wood sticks and ribbons - Christmas Tree
Christmas Scratch Art Paper Ornaments Kit Rainbow DIY Hanging Decorations With Wooden Sticks And Ribbons For Kids Party Favors
-4%
$1.62
Mix MOQ : 5
 · 
11 views
Christmas LED Glowing Glasses New Year Party Decoration Photo Props Santa Claus Reindeer Christmas Tree Festive Eyewear
Christmas LED Glowing Glasses New Year Party Decoration Photo Props Santa Claus Reindeer Christmas Tree Festive Eyewear
like
Find Similar
Christmas LED light-up glasses featuring Santa and Merry Christmas tree decorations - Christmas Glasses Style A / LED Glowing
Red LED Merry Christmas glasses with Santa and reindeer decor, dimensions 15.6x12.3cm - Christmas Glasses Style B / LED Glowing
Red Merry Christmas LED glasses frame with Santa reindeer decor and glitter finish - Christmas Glasses Style C / LED Glowing
Christmas LED light-up glasses featuring Jingle Bells Santa and candy cane decor - Christmas Glasses Style D / LED Glowing
+8
Christmas LED Glowing Glasses New Year Party Decoration Photo Props Santa Claus Reindeer Christmas Tree Festive Eyewear
-4%
$1.15
No MOQ
 · 
115 sold recently
Christmas Ornaments Wooden LED Glowing Light Up Tree Hanging Laser Cut Hollow Festive Decor Warm White
Christmas Ornaments Wooden LED Glowing Light Up Tree Hanging Laser Cut Hollow Festive Decor Warm White
like
Find Similar
Luminous Christmas tree wooden ornament with Santa and LED light for festive decor - Christmas Tree
Red teardrop wooden Christmas pendant with LED lights and Santa sleigh carving - Christmas Ball
Lighted wooden RV Christmas tree ornament with red camper and snowman design - Car Style
Star-shaped glowing wooden Christmas ornament with reindeer motif and warm LED light - Pentagram
Christmas Ornaments Wooden LED Glowing Light Up Tree Hanging Laser Cut Hollow Festive Decor Warm White
$2.25
No MOQ
 · 
12 views
Free Shipping
Christmas Stationery Set Wooden Pencils Ruler Eraser Sharpener Cartoon Santa Reindeer Student School Supplies Holiday Gift
Christmas Stationery Set Wooden Pencils Ruler Eraser Sharpener Cartoon Santa Reindeer Student School Supplies Holiday Gift
like
Find Similar
5-piece Christmas stationery set with pencils, ruler, eraser, and sharpener in red Santa theme - 5-Piece Cardboard Set (Red) / Red
5-piece Christmas stationery set with pencils, ruler, and eraser in festive red and green - 5-Piece Cardboard Set (Yellow) / Yellow
5-piece green Christmas stationery set with ruler, pencils, eraser and sharpener - 5-Piece Cardboard Set (Green) / Green
5-piece Christmas stationery set with pencils, ruler, eraser and sharpener in red-blue theme - 5-Piece Cardboard Set (Blue) / Blue
Christmas Stationery Set Wooden Pencils Ruler Eraser Sharpener Cartoon Santa Reindeer Student School Supplies Holiday Gift
-5%
$0.33
No MOQ
 · 
110 sold recently
Christmas Village House Miniature Luminous LED Light Resin Music Box Snow Scene Santa Claus Holiday Desktop Decoration
Christmas Village House Miniature Luminous LED Light Resin Music Box Snow Scene Santa Claus Holiday Desktop Decoration
like
Find Similar
Detailed view of glowing resin Christmas music box with snowy miniature house and Santa - Santa Claus
Detailed view of glowing LED Christmas snow cottage with miniature trees and music box - Doll Style
Christmas Village House Miniature Luminous LED Light Resin Music Box Snow Scene Santa Claus Holiday Desktop Decoration
$11.24
No MOQ
 · 
10 views
Christmas Wooden Hanging Ornaments Miniature Painted Nutcracker Train Angel For Holiday Tree Decoration Holiday Present
Christmas Wooden Hanging Ornaments Miniature Painted Nutcracker Train Angel For Holiday Tree Decoration Holiday Present
like
Find Similar
Set of 6 colorful wooden Christmas train ornaments in a festive red holiday gift box - Train Style / 6-Piece Set
Handcrafted red and white wooden Christmas ornaments set for tree decoration in gift box - Doll Style / 12pcs Set
Detailed view of 12-piece wooden Christmas ornaments set in a festive gift box - Rocking Horse Style / 12pcs Set
Christmas Wooden Hanging Ornaments Miniature Painted Nutcracker Train Angel For Holiday Tree Decoration Holiday Present
-4%
$2.14
No MOQ
 · 
15 sold recently
Christmas Jigsaw Puzzle Wooden Fiberboard With Portable Tin Box Educational Holiday Toy Santa Claus Pattern
Christmas Jigsaw Puzzle Wooden Fiberboard With Portable Tin Box Educational Holiday Toy Santa Claus Pattern
like
Find Similar
Rectangular Christmas tin box with Santa Claus and Snowman illustrations for candy storage - Style 1 [Snowy Field]
Christmas Santa Claus tin box for DIY puzzles with festive illustration and metal finish - Style 2 [Fireplace]
Rectangular Christmas tin box with Santa Claus illustration for DIY holiday gifting - Style 3 [Bedside]
Rectangular Christmas tin box with cartoon classroom illustration and rounded corners - Style 4 [Classroom]
Christmas Jigsaw Puzzle Wooden Fiberboard With Portable Tin Box Educational Holiday Toy Santa Claus Pattern
$1.59
No MOQ
 · 
37 views
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access