Everful

Wholesale snowmen

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Snowmen

Find the perfect pieces: christmas supplies, halloween supplies and more

All products in snowmen

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
3D Wooden Christmas Hanging Ornaments Hollow Laser Cut Tree Snowflake Star Bell Pendant Festive Party Decor
3D Wooden Christmas Hanging Ornaments Hollow Laser Cut Tree Snowflake Star Bell Pendant Festive Party Decor
like
Find Similar
Red laser-cut wooden Christmas snowflake ornament with bell motif and hanging rope - 3D Snowflake Style A [Red]
Bell-shaped wooden Christmas ornament with laser-cut Santa Claus and red hanging string - 3D Bell Style B [Natural Wood]
3D wooden laser-cut star ornament featuring a painted Christmas bear and red hanging cord - 3D Star Style B [Natural Wood]
White snowflake wooden Christmas ornament with green holly, gold bell and red string - 3D Snowflake Style B [White]
+4
3D Wooden Christmas Hanging Ornaments Hollow Laser Cut Tree Snowflake Star Bell Pendant Festive Party Decor
$0.58
Mix MOQ : 2
Christmas Wooden Hanging Ornaments Laser Cut Double Layer Hollow Snowflake Reindeer Tree Holiday Tree Decor White Natural
Christmas Wooden Hanging Ornaments Laser Cut Double Layer Hollow Snowflake Reindeer Tree Holiday Tree Decor White Natural
like
Find Similar
Laser-cut double-layer white wooden Christmas ornaments set with snowflake and heart shapes - Style A 9pcs/box
White Christmas wooden pendant set with snowflake and deer laser-cut patterns - Style B 9pcs/box
Three-piece laser-cut wooden Christmas ornaments set with reindeer and gingerbread motifs - Style C 9pcs/box
Christmas wooden snowflake and angel ornaments in dual-tone white and natural finish - Style D 9pcs/box
Christmas Wooden Hanging Ornaments Laser Cut Double Layer Hollow Snowflake Reindeer Tree Holiday Tree Decor White Natural
-5%
$2.19
Mix MOQ : 2
 · 
17 views
Christmas Tree Hanging Pendants Acrylic Crystal Transparent Glitter Snowflake Icicle Angel Star Holiday Home Decor
Christmas Tree Hanging Pendants Acrylic Crystal Transparent Glitter Snowflake Icicle Angel Star Holiday Home Decor
like
Find Similar
Set of 10 clear acrylic faceted teardrop ornaments for Christmas tree and home decor - Water Drops 10Pcs
Set of 10 clear acrylic 3cm snowflake crystals for Christmas tree decoration - Diamonds 10Pcs
Set of 10 clear acrylic water drop ornaments, 4cm ice crystal holiday tree pendants - Maple Leaves 10Pcs
Set of 6 white acrylic crystal snowflake ornaments for Christmas tree and window decor - Snowflakes 6Pcs
+26
Christmas Tree Hanging Pendants Acrylic Crystal Transparent Glitter Snowflake Icicle Angel Star Holiday Home Decor
-3%
$0.33-3.50
No MOQ
 · 
16 views
Free Shipping
Christmas Wooden Hanging Pendants Gingerbread Man Gnomes Snowflake Festive Ornament Colorful Home Decor With Wooden Box
Christmas Wooden Hanging Pendants Gingerbread Man Gnomes Snowflake Festive Ornament Colorful Home Decor With Wooden Box
like
Find Similar
Set of 3 painted wooden star ornaments with Santa and reindeer motifs in a wooden tray - 9-Piece Set - Style 4
Set of 12 red and white wooden Christmas tree ornaments featuring gingerbread man and reindeer - 12-Piece Set - Style 1
Set of four red and white wooden Christmas ornaments with star and horse shapes - 12-Piece Set - Style 2
Set of 4 Christmas wooden ornaments featuring reindeer, Santa, bear and snowman in box - 12-Piece Set - Style 3
+7
Christmas Wooden Hanging Pendants Gingerbread Man Gnomes Snowflake Festive Ornament Colorful Home Decor With Wooden Box
-4%
$1.92
No MOQ
Christmas Stationery Kit Plastic Wood Paper Pencils Ruler Eraser Sharpener Notebook Kids Students School Party Favors
Christmas Stationery Kit Plastic Wood Paper Pencils Ruler Eraser Sharpener Notebook Kids Students School Party Favors
like
Find Similar
6-piece Christmas stationery gift set for kids with pencil, ruler, and notebook - Red
Detailed Christmas stationery set including ruler, pencils and notebook in orange gift box - Yellow Style
Green Christmas stationery set showing ruler, pencil, and notepad in a holiday gift box - Green
Detailed view of a 6-piece blue Christmas stationery set with ruler, pencil, and notepad - Blue
Christmas Stationery Kit Plastic Wood Paper Pencils Ruler Eraser Sharpener Notebook Kids Students School Party Favors
$0.78
Mix MOQ : 2
 · 
131 sold recently
Christmas Party Glasses Frames Glitter Reindeer Antlers Santa Tree 2026 Xmas Decorative Eyewear Holiday Photo Props Novelty
Christmas Party Glasses Frames Glitter Reindeer Antlers Santa Tree 2026 Xmas Decorative Eyewear Holiday Photo Props Novelty
like
Find Similar
Christmas novelty glasses with red hat and green polka dots dimensions 15.5x14.4cm - Berry Red Top Hat
Detailed dimensions of 2026 Christmas glasses with green top hat and red polka dot frame - Berry Green Top Hat
Christmas glasses frame with gold top hat and green holly leaves decoration - Berry Gold Top Hat
Close-up of Xmas glitter glasses with reindeer design and product dimensions measurements - Xmas Red Elk Style
+92
Christmas Party Glasses Frames Glitter Reindeer Antlers Santa Tree 2026 Xmas Decorative Eyewear Holiday Photo Props Novelty
$0.30-0.77
Mix MOQ : 2
Christmas Hanging Ornaments Miniature Hand Painted Glass Multi Shape Festive Holiday Home Decor Party Decoration
Christmas Hanging Ornaments Miniature Hand Painted Glass Multi Shape Festive Holiday Home Decor Party Decoration
like
Find Similar
Set of 6 colorful hand-painted glass Christmas ornaments including Santa and Snowman - Style A (Set of 6)
Set of 6 colorful hand-painted glass Christmas ornaments in a black gift box - Style B (Set of 6)
Set of 9 hand-painted glass Christmas ornaments featuring Santa and Snowman in a gift box - Style C (Set of 9)
French fries glass Christmas ornament with 'FRIES BEFORE GUYS' text, 8x7cm size - French Fries
+20
Christmas Hanging Ornaments Miniature Hand Painted Glass Multi Shape Festive Holiday Home Decor Party Decoration
$1.96-8.88
No MOQ
Christmas Party Decoration Supplies Glasses Frames Hats Headbands Slap Bracelets Glitter Non-Woven Fabric Holiday
Christmas Party Decoration Supplies Glasses Frames Hats Headbands Slap Bracelets Glitter Non-Woven Fabric Holiday
like
Find Similar
10-piece set of festive Christmas glasses featuring reindeer antlers and holiday patterns - Christmas Glasses Set 5 (10pcs)
Set of 12 festive Christmas eyewear frames with reindeer antlers and santa motifs - Christmas Glasses Set 2 (12pcs)
Set of 9 festive Christmas party glasses with reindeer antlers and holiday themed designs - Christmas Glasses Set 1 (9pcs)
14-piece assorted Christmas novelty eyewear set with Santa and reindeer designs - Christmas Glasses Set 4 (14pcs)
+9
Christmas Party Decoration Supplies Glasses Frames Hats Headbands Slap Bracelets Glitter Non-Woven Fabric Holiday
$2.74-11.47
Mix MOQ : 2
 · 
10 views
Christmas Gift Tags Kraft Paper Hanging Labels Merry Christmas Ornaments Holiday Party Decor DIY Craft String
Christmas Gift Tags Kraft Paper Hanging Labels Merry Christmas Ornaments Holiday Party Decor DIY Craft String
like
Find Similar
50pcs multi-shape Christmas kraft paper gift tags with festive patterns and twine - S870 Style With Jute Twine / 50 Tags + 50 Ropes
Set of 48 kraft paper Christmas gift tags with festive patterns and cotton rope - S870 Style With Red White Twine / 50 Tags + 50 Ropes
Set of 50 vintage kraft paper Christmas gift tags with various holiday patterns and twine - S869 Style With Jute Twine / 50 Tags + 50 Ropes
50pcs Christmas gift tags set with reindeer and Santa designs on kraft paper - S869 Style With Red White Cotton Cord / 50 Tags + 50 Ropes
+2
Christmas Gift Tags Kraft Paper Hanging Labels Merry Christmas Ornaments Holiday Party Decor DIY Craft String
$1.12
No MOQ
 · 
10 sold recently
Christmas Advent Calendar Stickers Countdown Numbers Adhesive Square Paper Labels Gift Wrapping Envelope Seals Festive Pattern
Christmas Advent Calendar Stickers Countdown Numbers Adhesive Square Paper Labels Gift Wrapping Envelope Seals Festive Pattern
like
Find Similar
Christmas advent calendar stickers with numbered countdown patterns from one to twenty-five - T7711/ Set of 25 Pcs
Christmas Advent Calendar Stickers Countdown Numbers Adhesive Square Paper Labels Gift Wrapping Envelope Seals Festive Pattern
$0.14
No MOQ
 · 
120 sold recently
Christmas Skier Doll Ornaments Wooden Knitted Skiing Figurines Hanging Xmas Tree Decorations Winter Holiday Desktop Decor
Christmas Skier Doll Ornaments Wooden Knitted Skiing Figurines Hanging Xmas Tree Decorations Winter Holiday Desktop Decor
like
Find Similar
Christmas wooden skiing doll hanging ornament featuring red knit hat and striped legs - Red Skirt & Red Hat Skiing Girl Style E
Red and cream knitted Christmas skier doll with wooden skis and fuzzy beard ornament - Red Clothes & White Hat Skiing Santa Style A
Wooden skiing doll Christmas ornament featuring red and white striped knitwear - White Clothes & Striped Hat Skiing Boy Style D
Christmas skiing doll ornament with grey knit hat and wooden skis in gift packaging - Grey Hat & White Clothes Skiing Doll
+3
Christmas Skier Doll Ornaments Wooden Knitted Skiing Figurines Hanging Xmas Tree Decorations Winter Holiday Desktop Decor
-5%
$1.51
No MOQ
 · 
23 views
Christmas Wooden Hanging Ornament Welcome Letter Sign With Bells Snowflakes For Tree Decor Cartoon Gnomes Santa Reindeer
Christmas Wooden Hanging Ornament Welcome Letter Sign With Bells Snowflakes For Tree Decor Cartoon Gnomes Santa Reindeer
like
Find Similar
Wooden Christmas door hanging sign featuring Santa snowman reindeer and festive bells - R-C67 Santa Claus Wood Hanging Bell
Close-up of wooden Christmas welcome sign with gnome motifs and festive snowflake pendants - R-C68 Faceless Gnome Wood Hanging Bell
Christmas Wooden Hanging Ornament Welcome Letter Sign With Bells Snowflakes For Tree Decor Cartoon Gnomes Santa Reindeer
-4%
$1.62
No MOQ
Christmas Wooden Hanging Ornaments Tree Decorations Cartoon Reindeer Star Bell Shapes With Hanging Rope And Storage Box
Christmas Wooden Hanging Ornaments Tree Decorations Cartoon Reindeer Star Bell Shapes With Hanging Rope And Storage Box
like
Find Similar
Christmas wooden reindeer and Merry Christmas tags with colorful beads in a wooden box - Deer + Round Set (12pcs/box)
12-piece Christmas wooden sock and glove ornaments set in a natural wooden storage box - Socks + Gloves Set (12pcs/box)
Christmas wooden ornament set with penguin and reindeer designs in a divided gift box - Bell + Wooden House Set (12pcs/box)
Wooden Christmas tree and rocking horse ornaments with snowflakes in a gift box - Tree + Rocking Horse Set (12pcs/box)
+2
Christmas Wooden Hanging Ornaments Tree Decorations Cartoon Reindeer Star Bell Shapes With Hanging Rope And Storage Box
-5%
$2.08
No MOQ
Christmas Hair Clips Sequin Glitter Santa Reindeer Tree Spring Loaded Party Headwear For Kids Cartoon Holiday Decorations
Christmas Hair Clips Sequin Glitter Santa Reindeer Tree Spring Loaded Party Headwear For Kids Cartoon Holiday Decorations
like
Find Similar
Sparkly Santa Claus glitter hair clips set with spring design for Christmas festive decor - Glitter White Santa Claus Hair Clip
Set of four Christmas reindeer hair clips with golden glitter finish and red nose - Glitter Gold Reindeer Hair Clip
Christmas Santa Claus hair clips with red glitter and gold beard on metal springs - Glitter Gold Santa Claus Hair Clip
Set of 4 Christmas gift box hair clips with red and green glitter finish and springs - Glitter Gift Box Hair Clip
+5
Christmas Hair Clips Sequin Glitter Santa Reindeer Tree Spring Loaded Party Headwear For Kids Cartoon Holiday Decorations
$0.15
Mix MOQ : 2
Merry Christmas Stickers Rectangular Gift Box Sealing Labels Decorative Festive Holiday Stationery Adhesive Decals
Merry Christmas Stickers Rectangular Gift Box Sealing Labels Decorative Festive Holiday Stationery Adhesive Decals
like
Find Similar
Red and gold rectangular Merry Christmas stickers for holiday gift box sealing and wrapping - Style 1
Red and gold Merry Christmas stickers with sparkling tree design for gift sealing - Style 2
Red Merry Christmas stickers with Santa, snowman and penguin on a wood background - Style 3
Two-pack Merry Christmas rectangular stickers featuring Santa and penguin in festive colors - Style 4
+6
Merry Christmas Stickers Rectangular Gift Box Sealing Labels Decorative Festive Holiday Stationery Adhesive Decals
$0.06
Mix MOQ : 100
 · 
12 views
Merry Christmas Round Stickers Coated Paper Adhesive Labels For Holiday Gift Wrapping Envelope Sealing Santa Reindeer Decor
Merry Christmas Round Stickers Coated Paper Adhesive Labels For Holiday Gift Wrapping Envelope Sealing Santa Reindeer Decor
like
Find Similar
Roll of round Merry Christmas stickers featuring Santa and reindeer holiday designs - Style A / 25mm/1 Inch
Detail view of colorful round Christmas ball stickers with snowflakes on a paper roll - Style B / 25mm/1 Inch
Merry Christmas Round Stickers Coated Paper Adhesive Labels For Holiday Gift Wrapping Envelope Sealing Santa Reindeer Decor
$1.01-2.36
No MOQ
 · 
11 sold recently
Christmas Gift Label Stickers Kraft Paper To From Name Tags Holiday Present Decorative Decals Roll Patterns
Christmas Gift Label Stickers Kraft Paper To From Name Tags Holiday Present Decorative Decals Roll Patterns
like
Find Similar
Set of 4 kraft paper Christmas gift labels in a roll with festive holiday designs - 75*50MM (200 Labels/Roll)
Christmas Gift Label Stickers Kraft Paper To From Name Tags Holiday Present Decorative Decals Roll Patterns
$2.16
No MOQ
Christmas Pet Bow Tie Polyester Plaid Adjustable Necktie With Cartoon Resin Ornament For Small Medium Dogs Cats Holiday Party
Christmas Pet Bow Tie Polyester Plaid Adjustable Necktie With Cartoon Resin Ornament For Small Medium Dogs Cats Holiday Party
like
Find Similar
Christmas plaid pet bowtie with 3D Santa Claus figure and green elastic band - BT284-1/Santa Claus - Red & Green Plaid
Christmas pet bowtie with red green plaid pattern and 3D snowman ornament - BT284-3/Snowman - Red & Green Diagonal Plaid
Green plaid Christmas pet bowtie featuring a white snowflake accent for dogs and cats - BT284-4/Snowflake - Green & White Plaid
Christmas pet bowtie with red and black plaid pattern and white snowflake ornament - BT284-5/Snowflake - Red & Black Plaid
+4
Christmas Pet Bow Tie Polyester Plaid Adjustable Necktie With Cartoon Resin Ornament For Small Medium Dogs Cats Holiday Party
$0.49
Mix MOQ : 2
Free Shipping
Christmas Pet Bow Tie Adjustable Polyester Ribbon Necklace Festive Snowflake Pattern Collar For Cats And Small Dogs
Christmas Pet Bow Tie Adjustable Polyester Ribbon Necklace Festive Snowflake Pattern Collar For Cats And Small Dogs
like
Find Similar
Christmas pet bowtie for dogs and cats with snowflake pattern and red green ribbon - 1*(20-36)CM / Red Green Snowflake (VN098-2)
Christmas dog bowtie with red green snowflake ribbon and a sparkling rhinestone - 1*(20-36)CM / Red Green Snowflake Rhinestone (VN088-1)
Christmas dog bow tie with red snowflake ribbon, green layers, and central rhinestone - 1*(20-36)CM / Red Snowflake Dots Rhinestone (VN088-2)
Christmas pet bow tie featuring festive snowflake and gingerbread man ribbon patterns - 1*(20-36)CM / Red Green Gingerbread Man Rhinestone (VN088-3)
+37
Christmas Pet Bow Tie Adjustable Polyester Ribbon Necklace Festive Snowflake Pattern Collar For Cats And Small Dogs
$0.40
No MOQ
 · 
296 sold recently
Free Shipping
Pet Christmas Hat And Bow Tie Collar Polyester Grosgrain Ribbon Plush Adjustable Festive Holiday Accessories For Cats Dogs
Pet Christmas Hat And Bow Tie Collar Polyester Grosgrain Ribbon Plush Adjustable Festive Holiday Accessories For Cats Dogs
like
Find Similar
Close-up of Christmas pet bow tie with rhinestones, Merry Christmas pattern and snowman - VN394 Christmas Bowtie with Rhinestone
Detail of red Christmas pet bow tie with green bell and golden sequin trim edges - VN369 Red Shiny Edge with Bell
Christmas pet bowtie for dogs and cats with snowflake pattern and red green ribbon - VN098-2 Red Green Patchwork Snowflake
Mini Christmas pet hat in classic red and white plush with an elastic strap - Red Mini Christmas Hat
+15
Pet Christmas Hat And Bow Tie Collar Polyester Grosgrain Ribbon Plush Adjustable Festive Holiday Accessories For Cats Dogs
-4%
$0.41-0.96
No MOQ
 · 
33 views
Christmas Cake Toppers Santa Claus Reindeer Christmas Tree Decorations Soft Glue PVC Party Dessert Ornaments
Christmas Cake Toppers Santa Claus Reindeer Christmas Tree Decorations Soft Glue PVC Party Dessert Ornaments
like
Find Similar
Soft PVC Santa Claus cake topper decoration with Merry Christmas text for holiday desserts - Soft Glue Santa Claus Sign
Detailed view of a 5.3cm Santa Claus cake topper holding a gingerbread man figurine - 5# Soft Glue Santa with Gingerbread
6.3cm Santa Claus soft glue cake topper with stars background for Christmas decor - 7# Soft Glue Santa with Flask
Detailed view of a 5.3cm cartoon Santa Claus cake topper with a mini Christmas tree - 6# Soft Glue Santa Hugging Tree
+13
Christmas Cake Toppers Santa Claus Reindeer Christmas Tree Decorations Soft Glue PVC Party Dessert Ornaments
$0.05-0.46
Mix MOQ : 50
Christmas Cake Toppers Soft Glue Santa Claus Reindeer Gingerbread House Tree Dessert Decorations Festive Party Favors
Christmas Cake Toppers Soft Glue Santa Claus Reindeer Gingerbread House Tree Dessert Decorations Festive Party Favors
like
Find Similar
Christmas tree cake topper with red bow and colorful balls, 2.8cm wide and 4.7cm high - New 3D Christmas Tree
Detail view of 6cm tall spotted fawn cake topper figurine on star patterned tulle - Sika Deer
Detail of 5cm golden reindeer cake topper with metallic finish on white background - Golden Reindeer
Soft PVC Santa Claus cake topper decoration with Merry Christmas text for holiday desserts - Soft Glue Santa Claus Sign
+7
Christmas Cake Toppers Soft Glue Santa Claus Reindeer Gingerbread House Tree Dessert Decorations Festive Party Favors
$0.05-0.46
Mix MOQ : 100
Double Sided Satin Ribbon Glossy Polyester Tape For Gift Wrapping Flower Cake DIY Crafts Decoration Multi Colors
Double Sided Satin Ribbon Glossy Polyester Tape For Gift Wrapping Flower Cake DIY Crafts Decoration Multi Colors
like
Find Similar
Natural light brown twisted paper twine roll for rustic gift wrapping and DIY crafts - Paper / Kraft Paper Rope
1.5cm golden double-sided satin ribbon roll for gift wrapping and flower decoration - Webbing / Gold Glitter
Grass green and white twisted decorative paper twine rope for gift wrapping - Paper / Green and White Paper Rope
1.5cm width silver glitter grosgrain ribbon for gift boxes and flower packaging - Webbing / Silver Glitter
+30
Double Sided Satin Ribbon Glossy Polyester Tape For Gift Wrapping Flower Cake DIY Crafts Decoration Multi Colors
-13%
$0.24-3.20
No MOQ
 · 
81 sold recently
Free Shipping
Christmas Window Stickers Static Cling PVC Removable Reusable Santa Snowflakes Reindeer Home Glass Decor Holiday Atmosphere
Christmas Window Stickers Static Cling PVC Removable Reusable Santa Snowflakes Reindeer Home Glass Decor Holiday Atmosphere
like
Find Similar
Blue and white snowflake Christmas window clings set of 4 sheets with 111 decals - X Set (4 Sheets)
Detail view showing 4 sheets of Christmas window stickers with Santa and reindeer patterns - Y Set (4 Sheets)
Set of four Christmas static window clings featuring Santa, reindeer and snowflakes - Z Set (4 Sheets)
Detail view of 4-sheet Christmas window sticker set with 65 cartoon holiday decals - W Set (4 Sheets)
+16
Christmas Window Stickers Static Cling PVC Removable Reusable Santa Snowflakes Reindeer Home Glass Decor Holiday Atmosphere
$0.27-1.10
Mix MOQ : 2
Christmas Elf Leg Wreath Decoration Fabric Striped Stocking Hanging Ornament Festive Party Decor
Christmas Elf Leg Wreath Decoration Fabric Striped Stocking Hanging Ornament Festive Party Decor
like
Find Similar
Close-up of red and green knitted elf legs Christmas wreath hanging on a white wall - 470B Red Leg Style
Christmas elf legs wreath with red fabric and green striped stockings for tree decor - 470A Green Leg Style
Christmas snowman plush doll with long legs in red and green festive knitted outfit - 75B Snowman Style
Plush Christmas Santa Claus figure in yoga sitting pose with red and green knit outfit - 75A Santa Claus Style
+2
Christmas Elf Leg Wreath Decoration Fabric Striped Stocking Hanging Ornament Festive Party Decor
$4.61-5.76
No MOQ
Christmas Theme Charm Bracelet Alloy Copper Snake Chain Faceted Glass Beads Enamel Pendants Holiday Jewelry
Christmas Theme Charm Bracelet Alloy Copper Snake Chain Faceted Glass Beads Enamel Pendants Holiday Jewelry
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - 18cm / Silver Snake Chain Barrel Clasp
DIY Christmas tree beaded charm bracelet with green crystals and snowflake pendants - Green Christmas Tree Style SD-0028
Red Christmas charm bracelet with snowman bells and glass beads on adjustable snake chain - Red Bell Style SD-0032
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - Basic Snake Chain Lobster Clasp 18+5cm
+3
Christmas Theme Charm Bracelet Alloy Copper Snake Chain Faceted Glass Beads Enamel Pendants Holiday Jewelry
$0.73-2.49
No MOQ
Free Shipping
Christmas Charm Bracelet Santa Claus Bell Pendant Alloy Copper Snake Chain Glass Beads Festive Jewelry Gift
Christmas Charm Bracelet Santa Claus Bell Pendant Alloy Copper Snake Chain Glass Beads Festive Jewelry Gift
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - Silver Snake Base Chain (18cm)
Christmas DIY charm bracelet with Santa, red bells, and glass beads on a snake chain - Christmas Theme DIY Finished Beaded Bracelet
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - Silver Snake Base Chain (with Lobster Clasp 18+5cm)
+3
Christmas Charm Bracelet Santa Claus Bell Pendant Alloy Copper Snake Chain Glass Beads Festive Jewelry Gift
$0.73-3.67
No MOQ
 · 
10 views
Free Shipping
Christmas Beaded Charm Bracelet Alloy Enamel Glass Beads Santa Claus Christmas Tree Heart Pendant Festive Holiday Gift
Christmas Beaded Charm Bracelet Alloy Enamel Glass Beads Santa Claus Christmas Tree Heart Pendant Festive Holiday Gift
like
Find Similar
Silver snake chain bracelet for Christmas DIY charms with sleek cylindrical clasp - 18cm / Basic Snake Chain
Christmas charm bracelet with silver snake chain and red green holiday charms - Full Christmas Set/SD-0004
Silver snake chain bracelet with heart charm and lobster clasp for DIY Christmas jewelry - 18+5cm / Basic Lobster Clasp Chain
+3
Christmas Beaded Charm Bracelet Alloy Enamel Glass Beads Santa Claus Christmas Tree Heart Pendant Festive Holiday Gift
$0.73-4.06
No MOQ
Free Shipping
Antique Silver Alloy Large Hole Beads Charms For DIY Jewelry Making Bracelet Necklace Mixed Shapes Retro Style
Antique Silver Alloy Large Hole Beads Charms For DIY Jewelry Making Bracelet Necklace Mixed Shapes Retro Style
like
Find Similar
Antique silver charms set with heart, crown, and owl designs for DIY bracelets - Mixed 20pcs Antique Silver Alloy Large Hole Beads Set-SN730
Vintage silver alloy star bead with black gemstone inlay for DIY jewelry making - Five-pointed Star 10x7mm
Silver plated teddy bear bead with Christmas hat and scarf for DIY charm bracelets - Christmas Hat Teddy Bear 10x14mm
Vintage silver butterfly charm bead with intricate details for DIY bracelet making - Butterfly 13x11mm
+35
Antique Silver Alloy Large Hole Beads Charms For DIY Jewelry Making Bracelet Necklace Mixed Shapes Retro Style
$0.02-1.40
Mix MOQ : 2
 · 
770 sold recently
Embroidered Letter Patches Alphabet Embroidery Cloth Appliques Polyester Thread Christmas Halloween Winter Theme DIY Decor
Embroidered Letter Patches Alphabet Embroidery Cloth Appliques Polyester Thread Christmas Halloween Winter Theme DIY Decor
like
Find Similar
Adhesive sheets for strawberry alphabet patches, application guide 20cm x 10cm - One Sheet Strong Adhesive 20*10CM
Set of 26 Chenille alphabet letter patches with winter Christmas themed embroidery - Set of 26pcs Winter Theme
Set of 26 Halloween alphabet embroidery patches with pumpkin and ghost motifs on white - Set of 26pcs Halloween Theme
Detailed close-up of 26 Christmas alphabet patches with festive tree and snowman embroidery - Set of 26pcs Christmas Theme
+32
Embroidered Letter Patches Alphabet Embroidery Cloth Appliques Polyester Thread Christmas Halloween Winter Theme DIY Decor
$0.18-8.03
No MOQ
Free Shipping
Christmas Brooch Pins Alloy Enamel Reindeer Christmas Tree Santa Claus Stocking Holiday Jewelry Decoration For Women
Christmas Brooch Pins Alloy Enamel Reindeer Christmas Tree Santa Claus Stocking Holiday Jewelry Decoration For Women
like
Find Similar
Three-piece Christmas brooch set with cartoon tree, reindeer and gift box designs - Style 1 (Bell/Gift Box/Snowflake)
Three-piece Christmas enamel brooch set with snowman, stocking, and reindeer motifs - Style 2 (Snowman/Stocking/Reindeer Head)
Three-piece Christmas brooch set featuring Santa, Xmas tree, and candy cane designs - Style 3 (Candy Cane/Christmas Tree/Santa)
Three-piece Christmas brooch set with enamel reindeer, xmas tree, and sock designs - Style 4 (Stocking/Reindeer Head/Christmas Tree)
Christmas Brooch Pins Alloy Enamel Reindeer Christmas Tree Santa Claus Stocking Holiday Jewelry Decoration For Women
-13%
$0.87
No MOQ
Free Shipping
Silicone Christmas Mold Santa Hat Gloves Bell Gift Box Fondant Cake Decorating Tool DIY Resin Clay Handcrafted Dessert
Silicone Christmas Mold Santa Hat Gloves Bell Gift Box Fondant Cake Decorating Tool DIY Resin Clay Handcrafted Dessert
like
Find Similar
Pink silicone mold with Christmas bells, socks, stars, and gloves for DIY resin or fondant - 1# Christmas Theme / Pink
Pink silicone mold with 5 gift box and bow designs for fondant and clay crafts - 2# Gift Box Style / Pink
Christmas silicone mold featuring socks, bells, and stars for fondant and clay DIY projects - 1# Christmas Theme / Gray
5-cavity gift box silicone mold with colorful finished resin bow decorations - 2# Gift Box Style / Gray
Silicone Christmas Mold Santa Hat Gloves Bell Gift Box Fondant Cake Decorating Tool DIY Resin Clay Handcrafted Dessert
-4%
$0.66-0.85
No MOQ
Gingerbread Man Silicone Mold Christmas Halloween Theme Flexible Multi Cavity For Chocolate Fondant DIY Craft Baking
Gingerbread Man Silicone Mold Christmas Halloween Theme Flexible Multi Cavity For Chocolate Fondant DIY Craft Baking
like
Find Similar
White silicone mold featuring 6 gingerbread man designs for Christmas baking and DIY crafts - Gray
Pink silicone gingerbread man mold with 6 cavities for DIY fondant and chocolate - Pink
Gingerbread Man Silicone Mold Christmas Halloween Theme Flexible Multi Cavity For Chocolate Fondant DIY Craft Baking
-4%
$0.63
No MOQ
Glowing Multi-Tailed Fox Blind Box Figurine Translucent Resin Kitsune Desk Ornament Mythological Cartoon Lucky Mascot Decoration
Glowing Multi-Tailed Fox Blind Box Figurine Translucent Resin Kitsune Desk Ornament Mythological Cartoon Lucky Mascot Decoration
like
Find Similar
Collection of 九尾狐 fox figurine blind boxes in various colors with scenic background - -460 Oriental Poetic Nine-tailed Fox Set 12 / Full Box Set
Flocked Nine-Tailed Fox blind box figure on mossy rocks with a cherry blossom backdrop - -480 Nine-tailed Fox Flocked Set 9 / Full Box Set
Nine-Tailed Fox resin figure collection with 7 unique styles in Chinese mythical theme - -464 Mountain And Sea Nine-tailed Fox Set 6 / Full Box Set
The Wise Fox collection featuring seven colorful stylized nine-tailed fox blind box figurines - -468 Smart Fox Companion Set 6 / Full Box Set
+102
Glowing Multi-Tailed Fox Blind Box Figurine Translucent Resin Kitsune Desk Ornament Mythological Cartoon Lucky Mascot Decoration
$1.33-42.71
No MOQ
 · 
62 views
Christmas Tree Skirt Round Polyester Fabric Buffalo Plaid Santa Snowflakes Pattern Holiday Party Home Decor Base Cover
Christmas Tree Skirt Round Polyester Fabric Buffalo Plaid Santa Snowflakes Pattern Holiday Party Home Decor Base Cover
like
Find Similar
90cm red Christmas tree skirt with Merry Christmas prints and reindeer patterns - A-SQ50 Red Gift Santa Claus
Red Christmas tree skirt with golden snowflake prints and ribbon ties, 90cm diameter - A-SQ51 Red Gold Snowflake
90cm red Christmas tree skirt featuring Santa, Snowman and Reindeer cartoon illustrations - A-SQ53 Red Merry Christmas Cartoon
Christmas tree skirt with gnomes and red black plaid border for holiday decor - A-SQ77 Beige Burlap Gnome
+6
Christmas Tree Skirt Round Polyester Fabric Buffalo Plaid Santa Snowflakes Pattern Holiday Party Home Decor Base Cover
$2.82
No MOQ
Christmas Stickers Waterproof Vinyl Decals For Water Bottle Laptop Luggage DIY Scrapbook Cartoon Holiday Decoration Removable
Christmas Stickers Waterproof Vinyl Decals For Water Bottle Laptop Luggage DIY Scrapbook Cartoon Holiday Decoration Removable
like
Find Similar
Detail of colorful laser Christmas stickers featuring Santa, reindeer, and snowman designs - 8 Sheets 160pcs Christmas Sticker Set (P01)
Detailed fan-shaped stack of colorful waterproof Christmas stickers with festive patterns - Holographic 8 Sheets 160pcs Christmas Sticker Set (PQ03)
Christmas Stickers Waterproof Vinyl Decals For Water Bottle Laptop Luggage DIY Scrapbook Cartoon Holiday Decoration Removable
$1.15
Mix MOQ : 3
Resin Christmas Tree Flatback Charms Colorful Glitter Cartoon Santa Claus DIY Jewelry Making Phone Case Decor Craft
Resin Christmas Tree Flatback Charms Colorful Glitter Cartoon Santa Claus DIY Jewelry Making Phone Case Decor Craft
like
Find Similar
Detail of glittery green resin Christmas tree charm with colorful dots and 2x3.4cm size - Style A
Detail view of 2.3x3.1cm green resin Christmas tree charm for DIY craft accessories - Style B
Macro view of a 3.8x2.2cm resin Christmas tree flatback with Santa face and gold glitter - Style C
Detail of light green resin Christmas tree accessory with 2x2.7cm size specification - Style D-Light Green
+4
Resin Christmas Tree Flatback Charms Colorful Glitter Cartoon Santa Claus DIY Jewelry Making Phone Case Decor Craft
$0.08-0.12
No MOQ
Nativity Scene Ramadan Eid DIY Stickers Cartoon Religious Education Craft Paper Kids Christmas Party Home Decor
Nativity Scene Ramadan Eid DIY Stickers Cartoon Religious Education Craft Paper Kids Christmas Party Home Decor
like
Find Similar
24-set DIY Nativity scene door hanger stickers for kids featuring cartoon Jesus and angels - Nativity Doorknob Hanger Set
DIY Christmas Nativity Scene sticker set for kids featuring baby Jesus and stable characters - YS Nativity Scene Sticker Set
Nativity scene DIY sticker set for kids including 12 backgrounds and 12 sticker sheets - B5 Nativity Scene Sticker Set
Nativity scene DIY sticker set featuring Mary, Joseph, and baby Jesus decorations - Special Shape Nativity Manger Story Set
+13
Nativity Scene Ramadan Eid DIY Stickers Cartoon Religious Education Craft Paper Kids Christmas Party Home Decor
$0.58-4.76
No MOQ
 · 
50 sold recently
Free Shipping
3D Cartoon Animal Refrigerator Magnets Resin Cute Capybara Shiba Inu Fridge Magnet Blind Box For Home Kitchen Decor Party Gift
3D Cartoon Animal Refrigerator Magnets Resin Cute Capybara Shiba Inu Fridge Magnet Blind Box For Home Kitchen Decor Party Gift
like
Find Similar
Nine-Tailed Fox plush blind box set featuring 12 regular and 2 hidden edition figures - Eastern Poetry Nine-Tailed Fox (460) / Complete Box Set
Cartoon cat figurines sitting on gemstones with lucky charm pendants for home decor - A135 Emotional Value Kitty Box 6 / Full Box Set
Adorable animal blind box figures including elephant and pig with 6 regular and 1 hidden style - A133 Cute Wishing Charm Incense Burner Box 6 / Full Box Set
Flocked Nine-Tailed Fox blind box figure on mossy rocks with a cherry blossom backdrop - -480 Nine-tailed Fox Flocked Box 9 / Full Box Set
+92
3D Cartoon Animal Refrigerator Magnets Resin Cute Capybara Shiba Inu Fridge Magnet Blind Box For Home Kitchen Decor Party Gift
$1.33-51.18
No MOQ
 · 
24 views
Free Shipping
Cute Cartoon Animal Floral Printed Women Tote Bag Quilted Polyester Seersucker Handbag With Braided Handle Sweet Daily Casual
Cute Cartoon Animal Floral Printed Women Tote Bag Quilted Polyester Seersucker Handbag With Braided Handle Sweet Daily Casual
like
Find Similar
Detailed view of white bubble fabric tote bag with cartoon dogs and woven handles - Star Dog
Detail of white bubble cotton tote bag with cartoon print and woven handle on soft mat - Puppy Bear
Detail of white bubble fabric tote bag with bunny rabbit prints and orange woven handle - Small Grey Elephant
Detail of pink floral quilted tote bag with mint green woven handle on plush surface - Lusi Portrait
+4
Cute Cartoon Animal Floral Printed Women Tote Bag Quilted Polyester Seersucker Handbag With Braided Handle Sweet Daily Casual
$3.72
No MOQ
 · 
49 views
Vintage Metal Serving Tray Rectangular Decorative Tinplate Fruit Plate Embossed Pattern For Kitchen Home Snack Storage
Vintage Metal Serving Tray Rectangular Decorative Tinplate Fruit Plate Embossed Pattern For Kitchen Home Snack Storage
like
Find Similar
Silver rectangle tin plate with embossed fruit pattern 25x16cm decorative tray - Fruit & Vegetable
Silver rectangular coffee house embossed tin plate tray on grey plaid tablecloth - Coffee House
Vintage tinplate fruit tray with harvest engraving on checkered tablecloth - Harvest
Silver oval tinplate fruit tray featuring pastoral house embossed design 25x16cm size - Country Cottage
+6
Vintage Metal Serving Tray Rectangular Decorative Tinplate Fruit Plate Embossed Pattern For Kitchen Home Snack Storage
-4%
$0.80
No MOQ
 · 
31 views
Christmas Stickers Vinyl Waterproof Decorative Decals For Holiday Gift Wrapping Laptop Water Bottle Scrapbooking Designs
Christmas Stickers Vinyl Waterproof Decorative Decals For Holiday Gift Wrapping Laptop Water Bottle Scrapbooking Designs
like
Find Similar
Detail view of Merry Christmas stickers in packaging with 8cm by 9cm dimensions - 25 Original Designs (N52) / 50 Sheets
Detail view of holographic Christmas stickers with Santa Claus and red gift bag patterns - 25 Original Designs (N53) / 100 Sheets
Christmas Stickers Vinyl Waterproof Decorative Decals For Holiday Gift Wrapping Laptop Water Bottle Scrapbooking Designs
$0.75-1.51
Mix MOQ : 3
Quilted Fabric Coin Purse Small Card Holder Wallet With Snap Button Front Pocket And Metal Key Ring Cartoon Pattern
Quilted Fabric Coin Purse Small Card Holder Wallet With Snap Button Front Pocket And Metal Key Ring Cartoon Pattern
like
Find Similar
Detailed view of floral quilted pouch with bunny print, heart patterns, and keychain ring - Blue Dress Rabbit
Detailed view of quilted teddy bear organizer bag with flap closure and key ring - Diamond Bear
Detailed view of quilted fabric coin purse with floral patterns and keychain attachment - Badge Bear
Detailed view of quilted cream pouch with cute bear floral print and key ring - Lace Pastry
+21
Quilted Fabric Coin Purse Small Card Holder Wallet With Snap Button Front Pocket And Metal Key Ring Cartoon Pattern
$1.99
No MOQ
 · 
25 sold recently
Christmas Tree Resin Flatback Cabochons Glitter Miniature DIY Crafts Phone Case Scrapbooking Embellishments Holiday Decor
Christmas Tree Resin Flatback Cabochons Glitter Miniature DIY Crafts Phone Case Scrapbooking Embellishments Holiday Decor
like
Find Similar
Glitter green resin Christmas tree DIY accessory with red and white balls 2x2.8cm - 3-Glitter Green Star
DIY Christmas tree resin charm with red star and colorful beads, size 2.3x2.8cm - 8-Red Star
DIY resin Christmas tree charm with colorful glitter and gift box, style 7-Gift, 2.1x3cm size - 7-Gift Box
DIY resin Christmas tree charm in dark green with golden star and colorful dots - 10-Large Pentagram
+9
Christmas Tree Resin Flatback Cabochons Glitter Miniature DIY Crafts Phone Case Scrapbooking Embellishments Holiday Decor
$0.10
Mix MOQ : 10
Alphabet Letter Embroidered Patches Iron On Appliques Sporty Rugby Holiday Themes For Clothes Bags DIY Decorations
Alphabet Letter Embroidered Patches Iron On Appliques Sporty Rugby Holiday Themes For Clothes Bags DIY Decorations
like
Find Similar
Adhesive sheets for strawberry alphabet patches, application guide 20cm x 10cm - One Sheet Strong Adhesive 20*10CM
Rugby theme 26 alphabet embroidery patches set with football helmet and trophy icons - Set of 26 Team Series
Set of 26 strawberry alphabet embroidery patches with red fruits and green leaves - Set of 26 Strawberry Series
Macro shot of 26 pink bow-knot embroidered letters A-Z for garment and bag decoration - Set of 26 Bow Series
+32
Alphabet Letter Embroidered Patches Iron On Appliques Sporty Rugby Holiday Themes For Clothes Bags DIY Decorations
$0.21-8.03
No MOQ
 · 
27 views
Free Shipping
Shoulder Bag Polyester Seersucker Crinkle Texture Sweet Cartoon Bear Rabbit Print Korean Style Tote For Daily Use Women
Shoulder Bag Polyester Seersucker Crinkle Texture Sweet Cartoon Bear Rabbit Print Korean Style Tote For Daily Use Women
like
Find Similar
Close-up of white bubble fabric shoulder bag featuring cute dog prints and stars - Star Dog
Detail of white puffer tote bag with embossed bear pattern and soft bubble fabric texture - Puppy Bear
Detail of white quilted fabric with brown bear prints and colorful embroidered patch - Small Grey Elephant
Detailed view of pink tote bag with cat prints and embossed crinkle texture on sofa - Black Cat Pear
+9
Shoulder Bag Polyester Seersucker Crinkle Texture Sweet Cartoon Bear Rabbit Print Korean Style Tote For Daily Use Women
$3.72
No MOQ
 · 
26 sold recently
Women Cotton Crew Socks Vintage Fair Isle Jacquard Mid-calf Breathable Kawaii Cartoon Animal Heart Pattern Retro Style
Women Cotton Crew Socks Vintage Fair Isle Jacquard Mid-calf Breathable Kawaii Cartoon Animal Heart Pattern Retro Style
like
Find Similar
Retro Fair Isle crew socks in black with white geometric heart jacquard pattern - One Size / Black
Beige cotton socks with gray rabbit and heart Fair Isle patterns in crew length style - One Size / Cream
Light gray knit crew socks with festive white snowman, puppy and snowflake patterns - One Size / Light Gray
Pink and beige Fair Isle socks with grey cat and heart patterns in a cozy scene - One Size / Pink
+2
Women Cotton Crew Socks Vintage Fair Isle Jacquard Mid-calf Breathable Kawaii Cartoon Animal Heart Pattern Retro Style
$1.12
No MOQ
Quilted Makeup Bag Large Capacity Stationery Pouch Cartoon Animal Floral Print Cosmetic Organizer Travel Toiletry Bag
Quilted Makeup Bag Large Capacity Stationery Pouch Cartoon Animal Floral Print Cosmetic Organizer Travel Toiletry Bag
like
Find Similar
Quilted white cosmetic bag with cute dog prints and zipper on a stylish desk setup - Star Dog
Quilted cosmetic bag with cute animal prints on a desk with a laptop and accessories - Puppy Bear
Detail of quilted white makeup bag with brown bear pattern and beige zipper on soft fabric - Small Grey Elephant
Pink quilted makeup bag with cute cat and pear patterns on a desk with accessories - Black Cat Pear
+9
Quilted Makeup Bag Large Capacity Stationery Pouch Cartoon Animal Floral Print Cosmetic Organizer Travel Toiletry Bag
$2.28
No MOQ
 · 
1 reviews
Snake Chain Bracelet Copper Silver Plated Adjustable DIY Charm Jewelry For Women Fashion Base Link Minimalist
Snake Chain Bracelet Copper Silver Plated Adjustable DIY Charm Jewelry For Women Fashion Base Link Minimalist
like
Find Similar
Silver snake chain bracelet 19cm with 5cm heart extender and lobster clasp - 19cm+5cm Extender / Silver
Adjustable silver snake chain bracelet 14cm with 5cm heart charm extension - 14cm+5cm Extender / Silver
Silver adjustable snake chain bracelet with heart charm and lobster clasp, 16+5cm length - 16cm+5cm Extender / Silver
Rose gold snake chain bracelet with heart charm pendant and lobster clasp detail - 16cm+5cm Extender / Rose Gold
+8
Snake Chain Bracelet Copper Silver Plated Adjustable DIY Charm Jewelry For Women Fashion Base Link Minimalist
-6%
$0.11-0.91
Mix MOQ : 2
 · 
74 views
Free Shipping
Christmas Series Earring Pendant Silicone Molds DIY Crystal Epoxy Resin Casting Tool Snowflake Reindeer Tree Jewelry Making
Christmas Series Earring Pendant Silicone Molds DIY Crystal Epoxy Resin Casting Tool Snowflake Reindeer Tree Jewelry Making
like
Find Similar
DIY Christmas tree resin earring mold with precise size measurements in mm and inches - Christmas Series Pendant Earring Mold ED#29
Christmas reindeer silicone mold for epoxy resin earrings and pendants with dimensions - Christmas Series Pendant Earring Mold ED#30
DIY Christmas theme silicone mold for earrings and pendants featuring snowflake and snowman - Christmas Series Pendant Earring Mold ED#31
DIY Christmas snowflake silicone mold for resin pendants and earrings 115x112mm - Christmas Series Pendant Earring Mold ED#32
+3
Christmas Series Earring Pendant Silicone Molds DIY Crystal Epoxy Resin Casting Tool Snowflake Reindeer Tree Jewelry Making
-9%
$0.39-0.79
Mix MOQ : 2
 · 
16 views
Free Shipping
Floral Quilted Coin Purse Mini Storage Bag With Metal Ring Cartoon Animal Patterns Portable Card Earphone Organizer
Floral Quilted Coin Purse Mini Storage Bag With Metal Ring Cartoon Animal Patterns Portable Card Earphone Organizer
like
Find Similar
Macro detail of quilted floral coin purse with bear pattern and metal ring holder - Heart Baby Bear
Detailed view of pink quilted bag with cute cartoon bear and rabbit patterns on a desk - Donut Bear
Close-up of pink quilted floral organizer bag featuring cute cartoon bear and animal prints - Brown Zoo
Pink quilted floral pouch with cute rabbit print and white snap button for organizing storage - Pink Long-eared Character
+14
Floral Quilted Coin Purse Mini Storage Bag With Metal Ring Cartoon Animal Patterns Portable Card Earphone Organizer
-12%
$1.75
No MOQ
 · 
34 views
Women Quilted Shoulder Bag Bubble Textured Polyester Cartoon Floral Print Large Capacity Casual Daily Bag
Women Quilted Shoulder Bag Bubble Textured Polyester Cartoon Floral Print Large Capacity Casual Daily Bag
like
Find Similar
Close-up of white bubble fabric shoulder bag featuring cute dog prints and stars - Star Dog
Detail of white puffer tote bag with embossed bear pattern and soft bubble fabric texture - Puppy Bear
Detail of white quilted fabric with brown bear prints and colorful embroidered patch - Small Grey Elephant
Detailed view of pink tote bag with cat prints and embossed crinkle texture on sofa - Black Cat Pear
+9
Women Quilted Shoulder Bag Bubble Textured Polyester Cartoon Floral Print Large Capacity Casual Daily Bag
-4%
$3.54
No MOQ
 · 
15 views
Mini Animal Figurines Resin Cute Kawaii Cartoon Computer Screen Monitor Desktop Car Dashboard Edge Hanging Decor Ornaments
Mini Animal Figurines Resin Cute Kawaii Cartoon Computer Screen Monitor Desktop Car Dashboard Edge Hanging Decor Ornaments
like
Find Similar
Miniature white rabbit party figurine for computer screen or car dashboard decor - 32x38x26MM / Type A Rabbit
Miniature yellow duck screen monitor ornament for car and office desk decoration - 33x38x30MM / Type B Duck
Cute green frog mini ornament for car dashboard or monitor with matte finish - 32x35x22MM / Type C Frog
Miniature resin Shiba Inu figurine D-style for car dashboard and monitor decoration - 36x36x27MM / Type D Shiba Inu
+67
Mini Animal Figurines Resin Cute Kawaii Cartoon Computer Screen Monitor Desktop Car Dashboard Edge Hanging Decor Ornaments
$0.98-10.37
No MOQ
 · 
40 sold recently
Free Shipping
Seersucker Drawstring Storage Bag Portable Lightweight Bubble Fabric Pouch For Makeup Travel Sundries Organizing Cartoon Floral
Seersucker Drawstring Storage Bag Portable Lightweight Bubble Fabric Pouch For Makeup Travel Sundries Organizing Cartoon Floral
like
Find Similar
White cotton drawstring bag with animal and star patterns in a lifestyle setting - Star Dog
Close-up of a white quilted drawstring bag with cute bear patterns and puffy texture - Puppy Bear
Detail of white drawstring storage bag with brown bear print on textured fabric surface - Small Grey Elephant
Detailed view of pink seersucker drawstring bag with cartoon cat and bow pattern - Black Cat Pear
+9
Seersucker Drawstring Storage Bag Portable Lightweight Bubble Fabric Pouch For Makeup Travel Sundries Organizing Cartoon Floral
-5%
$0.54
No MOQ
 · 
16 views
Christmas Drop Earrings Alloy Acrylic Rhinestone Artificial Pearl Snowflake Santa Tree Festive Holiday Jewelry With Silver Earring Post
Christmas Drop Earrings Alloy Acrylic Rhinestone Artificial Pearl Snowflake Santa Tree Festive Holiday Jewelry With Silver Earring Post
like
Find Similar
Festive Christmas tree earrings with red glitter hearts and white tree pendants - Red Heart Silver Earring Post Earrings (23#)
Sparkling silver snowflake drop earrings with zircon crystals on a dark background - Silver Snowflake Zircon Silver Earring Post Pendant (22#)
Christmas tree drop earrings with green zircons, gold stars, and pearls on black velvet - Green Star Pearl Silver Earring Post Christmas Tree Style (2#)
Detail of Christmas snowflake earrings with red velvet bows and cream fur pom-poms - Gold Long Snowflake Bow Fur Ball Silver Earring Post Style (5#)
+17
Christmas Drop Earrings Alloy Acrylic Rhinestone Artificial Pearl Snowflake Santa Tree Festive Holiday Jewelry With Silver Earring Post
$0.54-3.12
No MOQ
Free Shipping
Christmas Charms Necklace And Bracelet 18K Gold Plated 316L Stainless Steel Enamel Reindeer Holiday Jewelry For Women
Christmas Charms Necklace And Bracelet 18K Gold Plated 316L Stainless Steel Enamel Reindeer Holiday Jewelry For Women
like
Find Similar
18K gold plated stainless steel bracelet with festive Christmas charms and size details - Articulated Handmade Chain Christmas Charm Bracelet - Gold
18K gold plated stainless steel paperclip necklace with festive Christmas charms and sizing - Paperclip Chain Christmas Charm Necklace - Gold
18K gold stainless steel paperclip necklace featuring festive Christmas charms and sizing details - Articulated Handmade Chain Christmas Charm Necklace - Gold
Christmas Charms Necklace And Bracelet 18K Gold Plated 316L Stainless Steel Enamel Reindeer Holiday Jewelry For Women
$9.71-10.85
No MOQ
Free Shipping
Christmas Silicone Molds Santa Reindeer Snowflake Bell Tree Shape Non Stick Reusable Fondant Chocolate Decorating Tools
Christmas Silicone Molds Santa Reindeer Snowflake Bell Tree Shape Non Stick Reusable Fondant Chocolate Decorating Tools
like
Find Similar
Pink silicone Christmas mold set featuring Santa, reindeer, and snowflake shapes - 6-Piece Set / Pink
Pink Christmas silicone mold with snowman, tree, and bell shapes for baking - US 4 / Pink
White silicone mold for Christmas fondant with snowman, tree, and snowflake patterns - US 4 / Gray
Pink holly leaf silicone mold for baking and chocolate craft with size markings - Number 2 / Pink
+10
Christmas Silicone Molds Santa Reindeer Snowflake Bell Tree Shape Non Stick Reusable Fondant Chocolate Decorating Tools
$0.40-3.40
No MOQ
 · 
81 views
Christmas DIY Journal Kit Notebook Stickers Cards Envelopes Crayons Pen Scrapbooking Holiday Gift Stationery
Christmas DIY Journal Kit Notebook Stickers Cards Envelopes Crayons Pen Scrapbooking Holiday Gift Stationery
like
Find Similar
Christmas DIY journal set with red gift box, stickers, and crayons for holiday gifting - SH028 Christmas Journal Set
Christmas DIY Journal Kit Notebook Stickers Cards Envelopes Crayons Pen Scrapbooking Holiday Gift Stationery
$7.44
Mix MOQ : 2
 · 
30 views
DIY Coloring Pillowcase Cushion Cover Faux Satin Line Art Mandala Flower Stress Relief Hand Painted Home Decor For Family
DIY Coloring Pillowcase Cushion Cover Faux Satin Line Art Mandala Flower Stress Relief Hand Painted Home Decor For Family
like
Find Similar
DIY Secret Garden coloring pillowcase with floral cat line art in white square design - Satin / Cats Paradise (AM21)
DIY coloring pillowcase featuring black line art of children and a snowman in winter - Satin / Snowman and Winter (AM27)
DIY Secret Garden coloring pillowcase with floral mandala pattern for creative gifts - Satin / Blooming Flowers (AM03)
DIY doodle pillowcase with kids in secret garden pattern for coloring - Satin / Children's Garden (AM10)
+36
DIY Coloring Pillowcase Cushion Cover Faux Satin Line Art Mandala Flower Stress Relief Hand Painted Home Decor For Family
$1.87-2.16
Mix MOQ : 3
 · 
42 sold recently
Christmas Tree Hanging Ornaments Painted Plastic Candy House Vehicle Carousel Novelty Holiday Festive Party Decoration
Christmas Tree Hanging Ornaments Painted Plastic Candy House Vehicle Carousel Novelty Holiday Festive Party Decoration
like
Find Similar
Christmas nutcracker soldier hanging ornament in red and black, size 16.5cm x 5.5cm - Soldier
Christmas donut ornament with red base and white frosting for holiday tree decoration - Red and White Donut Style
Festive snowman hanging ornament with red scarf and green tree for Christmas decor - Snowman
Christmas Santa Claus pendant ornament with snow texture and gold string, 11.5cm height - Santa Claus Single Pack
+16
Christmas Tree Hanging Ornaments Painted Plastic Candy House Vehicle Carousel Novelty Holiday Festive Party Decoration
$3.69-4.47
No MOQ
 · 
30 views
Free Shipping
Go to

More in party supplies

Explore more in snowmen

holidaypartyhangingdesktopmakinghandshapeswindowballpointbracelet necklace
diyresinmankidswarmsteelgirlsmetalphoneunisex

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access