Everful

Wholesale summer theme hair accessories

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Summer Theme Hair Accessories

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in summer theme hair accessories

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Sweet Dreamy Resin Hair Clip With Shell Flakes Inlay Geometric Oval Square Duckbill Side Clip Hair Accessories For Women
Sweet Dreamy Resin Hair Clip With Shell Flakes Inlay Geometric Oval Square Duckbill Side Clip Hair Accessories For Women
like
Find Similar
Dreamy blue seashell glitter resin hair clip with shiny shell fragments on white card - Oval Blue
Pink seashell resin hair clip with pearl finish on white card held by hand - Oval Pink
Handmade oval resin hair clip with blue shell fragments and glitter on a display card - Round Blue
Pink and white shell glitter resin hair clip displayed on a minimalist white card - Round Pink
+4
Sweet Dreamy Resin Hair Clip With Shell Flakes Inlay Geometric Oval Square Duckbill Side Clip Hair Accessories For Women
-5%
$0.53
No MOQ
French Retro Leopard Tortoise Shell Hair Claw Clips Large Rectangular Semi Circle Acetate Look Hair Clips For Women Hair Accessories
French Retro Leopard Tortoise Shell Hair Claw Clips Large Rectangular Semi Circle Acetate Look Hair Clips For Women Hair Accessories
like
Find Similar
Classic rectangle acetate hair claw clip with yellow and black tortoiseshell leopard pattern - Rectangle / Beige Tortoise (Rectangular Style)
French leopard print hair claw clip in tortoiseshell resin on a white plate - Semi-circle / Beige Tortoise (Semi-circular Style)
French leopard print rectangle hair claw clip with acetate finish for elegant women - Rectangle / Brown Tortoise (Rectangular Style)
French tortoise shell hair claw clip with amber and black pattern in a semi-round shape - Semi-circle / Brown Tortoise (Semi-circular Style)
+4
French Retro Leopard Tortoise Shell Hair Claw Clips Large Rectangular Semi Circle Acetate Look Hair Clips For Women Hair Accessories
-4%
$0.88-1.15
No MOQ
Stainless Steel Gold Plated Hair Clips Faux Artificial Pearl Flower Starfish Shell Designs Waterproof Hypoallergenic Hair Pins
Stainless Steel Gold Plated Hair Clips Faux Artificial Pearl Flower Starfish Shell Designs Waterproof Hypoallergenic Hair Pins
like
Find Similar
Detail view of 18k gold flower hair clips with white pearls and stainless steel texture - Gold Daisy 3-Piece Set (JDH2409003)
Detailed view of gold-plated stainless steel hair clips with shell and starfish motifs - Gold Marine Elements 3-Piece Set (JDH2409006)
Three-piece gold stainless steel hair clips with starfish shell and pearl designs - Gold Starfish Pearl 3-Piece Set (JDH2409007)
Detailed view of ocean themed hair clips with starfish and shells in gold finish - Gold Shell Conch 3-Piece Set (JDH2409008)
Stainless Steel Gold Plated Hair Clips Faux Artificial Pearl Flower Starfish Shell Designs Waterproof Hypoallergenic Hair Pins
$8.36-10.09
No MOQ
 · 
10 views
Free Shipping
Sweet Sea Style Starfish Flower Hair Clip Resin Handmade Duckbill Clip For Beach Vacation Photography Women Kids Jewelry
Sweet Sea Style Starfish Flower Hair Clip Resin Handmade Duckbill Clip For Beach Vacation Photography Women Kids Jewelry
like
Find Similar
Sweet floral hair clip with pink and blue fabric flowers on cream acrylic base - 3D Floral Decoration Large Claw Clip
Cream starfish hair clip with blue flowers and pink ribbon on display card - Starfish Duckbill Clip / Pink Flower Style
Starfish and blue silk flower hair clip set on a designer brand packaging card - Starfish Duckbill Clip / Blue Floral
Blue starfish hair clip with realistic texture on original brand display card - Solid Color Starfish Clip / Aqua
+5
Sweet Sea Style Starfish Flower Hair Clip Resin Handmade Duckbill Clip For Beach Vacation Photography Women Kids Jewelry
$0.26-1.07
No MOQ
Ocean Style Whale Shell Hair Claws For Women PVC Rhinestone Pearlized Marine Theme Hair Clip Accessories Daily Vacation
Ocean Style Whale Shell Hair Claws For Women PVC Rhinestone Pearlized Marine Theme Hair Clip Accessories Daily Vacation
like
Find Similar
Iridescent blue shell hair claw clip with white stripes and detailed size measurements - Shell Style (C3-4-10) / Fog Blue Shell
Pink ocean seashell claw clip with iridescent glitter and white vein details - Shell Style (C3-4-9) / Soft Pink Shell
Pearlescent white acetate shell hair claw clip with elegant marble texture pattern - Shell Style (C3-4-11) / Moonlight White Shell
Iridescent light blue whale hair claw clip with colorful sequins and white outlines - Whale Style (C3-4-13) / Fog Blue Whale
+5
Ocean Style Whale Shell Hair Claws For Women PVC Rhinestone Pearlized Marine Theme Hair Clip Accessories Daily Vacation
$1.21
Mix MOQ : 2
Ocean Theme Gold Silver Starfish Conch Shell Metal Hair Clips Elegant Alloy Hair Accessories For Beach Vacation Women
Ocean Theme Gold Silver Starfish Conch Shell Metal Hair Clips Elegant Alloy Hair Accessories For Beach Vacation Women
like
Find Similar
Elegant gold shell hair clip with glossy metallic spiral texture for women - Gold Conch Style / Gold
Elegant silver metallic shell hair clip with textured radial ridges for women - Silver Shell Style / Silver
Fashionable silver starfish brooch with textured alloy surface and elegant sea-inspired design - Silver Starfish Style / Silver
Polished silver seashell hair clip accessory with realistic spiral texture and metallic shine - Silver Snail Style / Silver
+5
Ocean Theme Gold Silver Starfish Conch Shell Metal Hair Clips Elegant Alloy Hair Accessories For Beach Vacation Women
$0.46-2.77
Mix MOQ : 2
Cute Mini Sea Snail Shell Acrylic Hair Claw Clips Sweet Animal Shark Hair Clips For Kids Girls Fashion Daily Hair Accessories
Cute Mini Sea Snail Shell Acrylic Hair Claw Clips Sweet Animal Shark Hair Clips For Kids Girls Fashion Daily Hair Accessories
like
Find Similar
Pair of cute blue ocean wave pattern acrylic hair claws with marble texture - Cyan Conch
Cute red and white striped shell acrylic hair claw clip for a sweet ocean aesthetic - Red Snail
Cute yellow cat ear hair claw clip with pearlescent texture and black dot patterns - Yellow Conch
Pair of shell-shaped acrylic earrings with yellow-orange gradient and glossy finish - Orange Shell
+7
Cute Mini Sea Snail Shell Acrylic Hair Claw Clips Sweet Animal Shark Hair Clips For Kids Girls Fashion Daily Hair Accessories
-5%
$1.26
No MOQ
Free Shipping
Plumeria Flower Hair Claw Gradient Color Summer Tropical Beach Hair Clip Resin Shark Grab Clip Vacation Accessory For Women
Plumeria Flower Hair Claw Gradient Color Summer Tropical Beach Hair Clip Resin Shark Grab Clip Vacation Accessory For Women
like
Find Similar
Detailed view of 7cm translucent frangipani flower hair claw on a ceramic plate - Gradient Creamy Yellow Style (735001)
Detailed macro view of a 7cm light blue translucent frangipani flower hair claw clip - Gradient Light Blue Style (735002)
Detail of pink gradient frangipani flower hair claw clip on a textured beige ceramic plate - Gradient Pink Style (735003)
Detailed macro view of an orange translucent plumeria hair claw clip on a beige ceramic plate - Gradient Orange Red Style (735004)
+3
Plumeria Flower Hair Claw Gradient Color Summer Tropical Beach Hair Clip Resin Shark Grab Clip Vacation Accessory For Women
-4%
$0.41-2.06
No MOQ
Vintage Acetate Mini Hair Claw Clip For Women Geometric Tortoise Shell Leopard Print Small Hairpin Accessory
Vintage Acetate Mini Hair Claw Clip For Women Geometric Tortoise Shell Leopard Print Small Hairpin Accessory
like
Find Similar
Detailed view of a cream acetate hair claw clip on a white coral texture background - White
Detailed view of a small tortoiseshell hair claw clip on a vintage background - Dark Tortoiseshell
Artistic close-up of a tortoiseshell acetate hair claw clip on a white coral display - Light Tortoiseshell
Close-up of small vintage acetate hair claw with dark amber texture on white decorative tray - Dark Coffee
+3
Vintage Acetate Mini Hair Claw Clip For Women Geometric Tortoise Shell Leopard Print Small Hairpin Accessory
-4%
$0.77
No MOQ
Free Shipping
Matte Gradient Flower Hair Claw Clip Large Hibiscus Shark Clip Summer Beach Vacation Style Hair Accessory For Women
Matte Gradient Flower Hair Claw Clip Large Hibiscus Shark Clip Summer Beach Vacation Style Hair Accessory For Women
like
Find Similar
Close-up of white and yellow gradient plumeria hair claw clip on a woven tray - White Flower with Yellow Center
Macro detail of large gradient flower hair claw clip with matte frosted texture finish - White Flower with Red Center
Close-up of a matte pink floral hair claw clip with dark red gradient details - Pink Flower
Close-up of matte gradient yellow flower hair claw clip with interlocking teeth on tray - Yellow Flower
+2
Matte Gradient Flower Hair Claw Clip Large Hibiscus Shark Clip Summer Beach Vacation Style Hair Accessory For Women
$0.63
No MOQ
Starfish Hair Clips Frosted Sugar Texture Metal Duckbill Clips Sweet Summer Beach Hair Accessories For Women Girls
Starfish Hair Clips Frosted Sugar Texture Metal Duckbill Clips Sweet Summer Beach Hair Accessories For Women Girls
like
Find Similar
Pair of white starfish hair clips with sugar crystal texture on gold metal duckbill base - White (B3308)
Pink starfish hair clips set with frosted sugar texture and gold duckbill base - Pink
Pair of stylish yellow starfish hair clips with textured crystalline finish for women - Yellow
Close-up of two bright orange starfish hair clips with glitter on white card - Orange
+2
Starfish Hair Clips Frosted Sugar Texture Metal Duckbill Clips Sweet Summer Beach Hair Accessories For Women Girls
$0.85
Mix MOQ : 2
Free Shipping
Elegant Acetate Heart Shaped Hair Clip For Women Korean Style Marble Texture Tortoise Shell Pattern Side Clip Hair Accessory
Elegant Acetate Heart Shaped Hair Clip For Women Korean Style Marble Texture Tortoise Shell Pattern Side Clip Hair Accessory
like
Find Similar
Chic heart-shaped hair clip with orange marble pattern made of premium acetate fiber - Yellow
Sparkly heart-shaped hair clip with purple and blue starry marble acetate pattern - Blue
Macro detail of heart-shaped hair clip with marble textured acetate on display card - Gray
Beige marble pattern heart hair clip on a white card display with elegant texture - Beige
+3
Elegant Acetate Heart Shaped Hair Clip For Women Korean Style Marble Texture Tortoise Shell Pattern Side Clip Hair Accessory
$0.27
No MOQ
Vintage Cellulose Acetate Hair Comb Retro Marble Tortoise Shell Pattern Portable Half Moon Pocket Comb For Women Styling Hair Tool
Vintage Cellulose Acetate Hair Comb Retro Marble Tortoise Shell Pattern Portable Half Moon Pocket Comb For Women Styling Hair Tool
like
Find Similar
Retro acetate hair comb with classic amber tortoiseshell pattern and curved shape - Dark Color
Portable acetate hair comb featuring vintage tortoiseshell pattern and half-moon shape - Light Color
Acetate hair comb with elegant black and white marble pattern in a crescent shape - Black and White Speckled
Portable acetate hair comb with black and grey marble texture in a crescent moon shape - Black and Gray Floral
+6
Vintage Cellulose Acetate Hair Comb Retro Marble Tortoise Shell Pattern Portable Half Moon Pocket Comb For Women Styling Hair Tool
$2.28
Mix MOQ : 2
Vintage Acetate Tortoise Shell Banana Hair Clip Fashion Leopard Print Marble Pattern Hair Accessories For Women Daily
Vintage Acetate Tortoise Shell Banana Hair Clip Fashion Leopard Print Marble Pattern Hair Accessories For Women Daily
like
Find Similar
Grey tortoise shell pattern banana hair clip with secure black comb teeth for women - Bulk (No Packaging) / #1 Light Tortoise (13cm)
Classic tortoiseshell pattern banana hair clip with black teeth for women - Bulk (No Packaging) / #2 Dark Tortoise (13cm)
Classic tortoiseshell patterned acetate banana hair clip for women in amber and black colors - Bulk (No Packaging) / #3 Blue Coffee (13cm)
Chic acetate banana hair clip with elegant cream marble texture on a black base - Bulk (No Packaging) / #5 Rice Flower (13cm)
+6
Vintage Acetate Tortoise Shell Banana Hair Clip Fashion Leopard Print Marble Pattern Hair Accessories For Women Daily
$1.67-1.71
No MOQ
Colorful Ocean Creature PVC Hair Claw Clips Series Summer Beach Jellyfish Starfish Seahorse Lobster Shark Clips For Women Hair Accessories
Colorful Ocean Creature PVC Hair Claw Clips Series Summer Beach Jellyfish Starfish Seahorse Lobster Shark Clips For Women Hair Accessories
like
Find Similar
Pink shell hair claw clip with nautical resin texture and white ocean patterns - 8.5cm / Pink Shell
Blue and pink gradient jellyfish hair claw clip made of pearlescent acetate material - 8.5cm / Iridescent Jellyfish
Translucent acrylic hair claw clip with orange coral pattern and 8cm length - 8cm / Coral
Blue starfish and pink shell hair claw clip with coral design, 3.5 inches length - 8.9CM / Starfish
+6
Colorful Ocean Creature PVC Hair Claw Clips Series Summer Beach Jellyfish Starfish Seahorse Lobster Shark Clips For Women Hair Accessories
$1.35
Mix MOQ : 2
Hair Braid Rings With Alloy Shell Star Pendant Charms For DIY Dreadlocks Decoration Fashion Accessories
Hair Braid Rings With Alloy Shell Star Pendant Charms For DIY Dreadlocks Decoration Fashion Accessories
like
Find Similar
Variety of silver metal pendants and natural shells for DIY hair braiding accessories - 50Pcs Silver Set
50pcs dreadlock hair jewelry set with gold star, shell, and butterfly metal pendants - 50Pcs Gold Set
Hair Braid Rings With Alloy Shell Star Pendant Charms For DIY Dreadlocks Decoration Fashion Accessories
$1.87
Mix MOQ : 2
Elegant Rectangular Acetate Hair Claw Clips French Leopard Print Tortoise Shell Hollow Design For Women
Elegant Rectangular Acetate Hair Claw Clips French Leopard Print Tortoise Shell Hollow Design For Women
like
Find Similar
Detailed macro view of an amber leopard print acetate hair claw on a silk beige fabric - Dark Leopard Print
Detail shot of a rectangular tortoiseshell acetate hair claw on a beige leather pad - Light Leopard
Elegant Rectangular Acetate Hair Claw Clips French Leopard Print Tortoise Shell Hollow Design For Women
-4%
$1.15
No MOQ
Gothic Viking Hair Stick Antique Gold Silver Alloy Crow Skull Antler Moon Shell Teardrop Gem Hair Pin For Women Party Jewelry
Gothic Viking Hair Stick Antique Gold Silver Alloy Crow Skull Antler Moon Shell Teardrop Gem Hair Pin For Women Party Jewelry
like
Find Similar
Gothic antler skull hair pin set with crescent moon in antique gold finish - Antique Gold
Gothic antler hair pin and ring set with raven skull and iridescent crescent moon stone - Antique Silver
Gothic Viking Hair Stick Antique Gold Silver Alloy Crow Skull Antler Moon Shell Teardrop Gem Hair Pin For Women Party Jewelry
$1.21
Mix MOQ : 2
Vintage Metallic Shell Hair Claw Clip For Women Large Small Scallop Shark Clip Elegant Plastic Hair Accessories
Vintage Metallic Shell Hair Claw Clip For Women Large Small Scallop Shark Clip Elegant Plastic Hair Accessories
like
Find Similar
Detailed view of the shell-shaped bronze hair claw with a shimmering glitter finish - Large / Large Orange Red
Close-up of silver shell-shaped hair claw clip with metallic finish and striped texture - Large / Large Silver
Detail view of champagne gold scallop hair claw with metallic pearl finish and smooth teeth - Large / Large Gold
Detail view of shell-shaped hair claw clip with dark grey glitter finish and black teeth - Large / Large Coffee
+4
Vintage Metallic Shell Hair Claw Clip For Women Large Small Scallop Shark Clip Elegant Plastic Hair Accessories
$0.57-0.66
No MOQ
Heart Shaped Hair Claw Clip Hollow Leopard Print Tortoise Shell Matte PC Hair Accessories For Women Daily Styling
Heart Shaped Hair Claw Clip Hollow Leopard Print Tortoise Shell Matte PC Hair Accessories For Women Daily Styling
like
Find Similar
Matte heart hair clip in morandi brown with hollow design and spring claw grip - Khaki
Minimalist matte apricot hollow heart hair clip with durable resin claw teeth for women - Cinnamon Pink
Minimalist matte black heart-shaped hair clip with hollow design for women - Black
Minimalist matte cream beige heart-shaped hair clip with elegant hollow double heart design - White
+4
Heart Shaped Hair Claw Clip Hollow Leopard Print Tortoise Shell Matte PC Hair Accessories For Women Daily Styling
-4%
$0.96
No MOQ
Women Sweet Ocean Theme PVC Hair Claw Clip Shell Conch Shape Artificial Pearl Finish Glitter Gradient Vacation Style Hair Accessories
Women Sweet Ocean Theme PVC Hair Claw Clip Shell Conch Shape Artificial Pearl Finish Glitter Gradient Vacation Style Hair Accessories
like
Find Similar
Iridescent turquoise shell hair claw clip with colorful glitter and white texture - Conch Style / Light Blue Conch
Dreamy light blue seashell and starfish hair claw clip with iridescent finish - Shell Starfish Style / Light Blue Shell
Pink seashell-shaped hair claw clip with pearlescent finish and blue dot detail - Conch Style / Soft Pink Conch
Blue and white gradient shell hair claw clip with elegant marble pattern for women - Conch Style / Dreamy Blue Conch
+4
Women Sweet Ocean Theme PVC Hair Claw Clip Shell Conch Shape Artificial Pearl Finish Glitter Gradient Vacation Style Hair Accessories
$1.21
Mix MOQ : 2
Tie Dye Sporty Headband Twisted Knot Elastic Breathable Yoga Hair Band For Women Workout Outdoor
Tie Dye Sporty Headband Twisted Knot Elastic Breathable Yoga Hair Band For Women Workout Outdoor
like
Find Similar
Breathable yoga headband with brown tie-dye twist pattern for sports and outdoor workout - 5# (Brown Khaki Tie-Dye)
Tie-dye cross knot yoga headband in dark blue and grey brown gradient wash - 6# (Dark Blue Grey Brown Tie-Dye)
Tie-dye cross knot headband featuring blue yellow and pink gradient for yoga and fitness - 1# (Blue Yellow Pink Tie-Dye)
Blue and green tie-dye athletic headband with a central twist knot design - 2# (Blue Green Tie-Dye)
+2
Tie Dye Sporty Headband Twisted Knot Elastic Breathable Yoga Hair Band For Women Workout Outdoor
$0.61
No MOQ
Large Cellulose Acetate Hair Claw Clip French Style Tortoise Shell Leopard Print Non-Slip Shark Clip Hair Accessories For Women
Large Cellulose Acetate Hair Claw Clip French Style Tortoise Shell Leopard Print Non-Slip Shark Clip Hair Accessories For Women
like
Find Similar
Large acetate hair claw clip with tortoise shell pattern and glossy finish for thick hair - Leopard Print (11cm)
Macro shot of curved acetate hair claw clip with pearlescent finish and golden logo - Mermaid Pearl White (11cm)
Elegant amber tortoiseshell acetate hair claw clip with La France logo for thick hair - Light Leopard Print (11cm)
Close-up of black acetate hair claw with gold Barrette La France lettering on white background - Glossy Black (11cm)
+1
Large Cellulose Acetate Hair Claw Clip French Style Tortoise Shell Leopard Print Non-Slip Shark Clip Hair Accessories For Women
$3.40
No MOQ
Free Shipping
Elegant Heart Acetate Hair Claw Clip French Vintage Marbled Tortoise Shell Hair Accessory For Women Small Ponytail Holder
Elegant Heart Acetate Hair Claw Clip French Vintage Marbled Tortoise Shell Hair Accessory For Women Small Ponytail Holder
like
Find Similar
Detailed side view of a pearlescent white acetate heart claw clip with gold metal frame - 1# Mermaid White
Detailed close-up of a heart-shaped acetate hair claw clip with golden metal spring components - White
Close-up of heart-shaped marble acetate hair claw clip with pink and cream textures - Pink Purple
Pink marble acetate heart-shaped hair claw clip with gold metal spring for women - 4# Pink and White
+5
NewElegant Heart Acetate Hair Claw Clip French Vintage Marbled Tortoise Shell Hair Accessory For Women Small Ponytail Holder
$1.61
No MOQ
Free Shipping
Vintage French Acetate Hollow Out Fan Shaped Shell Hair Claw Clip For Women Fashion Marble Leopard Print Hair Accessories
Vintage French Acetate Hollow Out Fan Shaped Shell Hair Claw Clip For Women Fashion Marble Leopard Print Hair Accessories
like
Find Similar
Detailed macro view of the marble pattern tortoiseshell finish on the acetate hair claw clip - 1# Light Leopard
French retro acetate shell claw clip in tortoise shell pattern for women's hair styling - Dark Leopard
Macro detail of medium acetate shell claw clip with iridescent colorful gradient finish - Iridescent Blue Purple
Detail of medium acetate shell hair claw with pink marble texture and hollowed design - Floral Pink
+5
Vintage French Acetate Hollow Out Fan Shaped Shell Hair Claw Clip For Women Fashion Marble Leopard Print Hair Accessories
-4%
$1.92
No MOQ
Free Shipping
Elegant Cellulose Acetate Hair Claw Clip For Women Retro Tortoise Shell Marble Pattern Floral Hair Jaw Clip Hair Accessory
Elegant Cellulose Acetate Hair Claw Clip For Women Retro Tortoise Shell Marble Pattern Floral Hair Jaw Clip Hair Accessory
like
Find Similar
Detail view showing tortoise shell hair claw clip size measurement on wooden table - Vivid Colors
Detailed view of an 8cm amber acetate hair claw clip with scale measurement on red background - Pastel Colors
Macro view showing the marbled tortoiseshell pattern and claw design of the acetate hair clip - Mint Floral Series
Detail of elegant tortoiseshell acetate hair claw clip with blue and brown marble pattern - Blue Floral
+5
Elegant Cellulose Acetate Hair Claw Clip For Women Retro Tortoise Shell Marble Pattern Floral Hair Jaw Clip Hair Accessory
-4%
$1.78
Mix MOQ : 2
Free Shipping
Tropical Fish Marine Animal Hair Claw Clips Colorful Acetate Marine Life Shaped Hair Clips For Women Girls Summer Beach Accessories
Tropical Fish Marine Animal Hair Claw Clips Colorful Acetate Marine Life Shaped Hair Clips For Women Girls Summer Beach Accessories
like
Find Similar
Blue and orange tropical fish hair claw clip made of acetate with dimensions 4.3x1.6 inch - Catfish Style (D7-3-7)
Pink and yellow striped tropical fish hair claw clip made of acetate, size 8.6cm - Yellow Fish Style (D7-3-1)
Tropical fish hair claw clip in blue marbled acetate with beach background detail - Blue Grouper Style (D7-3-5)
Clownfish hair claw clip in orange with black stripes for tropical ocean themed hair styling - Tiger Fish Style (D7-3-2)
+5
Tropical Fish Marine Animal Hair Claw Clips Colorful Acetate Marine Life Shaped Hair Clips For Women Girls Summer Beach Accessories
-5%
$1.23
Mix MOQ : 2
Baby Girls Knit Bow Headband And Daisy Flower Sunglasses UV Protection Summer Outdoor Infant Toddler Hair Accessories
Baby Girls Knit Bow Headband And Daisy Flower Sunglasses UV Protection Summer Outdoor Infant Toddler Hair Accessories
like
Find Similar
Detailed set of light blue baby nylon headband with large bow and daisy round sunglasses - Light Blue Headband And Glasses Set
Detail of baby headband with knit bow and daisy sunglasses on a white display card - Beige Headband And Glasses Set
Pink bow headband and daisy floral sunglasses 2-piece set for baby girls' summer sun protection - Light Pink Headband And Glasses Set
Close-up of pink baby bow headband and sunglasses with floral detail on display card - Dusty Rose Headband And Glasses Set
+2
Baby Girls Knit Bow Headband And Daisy Flower Sunglasses UV Protection Summer Outdoor Infant Toddler Hair Accessories
$2.01
Mix MOQ : 2
Flower Hair Claw Clip Resin Gradient Plumeria Shape Accessory Beach Vacation Y2K Retro Bohemian For Women
Flower Hair Claw Clip Resin Gradient Plumeria Shape Accessory Beach Vacation Y2K Retro Bohemian For Women
like
Find Similar
Detail of blue and green Plumeria flower hair claw clip with strong resin grip teeth - Blue
Y2K yellow plumeria flower hair claw clip with a natural gradient resin finish - Yellow
Detail view of pink gradient Y2K flower hair claw clip with smooth resin texture - Rose Red
Detailed view of Y2K gradient pink flower hair claw clip with glossy acrylic finish - Orange
+2
Flower Hair Claw Clip Resin Gradient Plumeria Shape Accessory Beach Vacation Y2K Retro Bohemian For Women
-4%
$0.58
No MOQ
Hollow Heart Hair Clip Acetate Duckbill Side Clip French Style Marble Tortoise Shell Pattern Hair Accessory For Women
Hollow Heart Hair Clip Acetate Duckbill Side Clip French Style Marble Tortoise Shell Pattern Hair Accessory For Women
like
Find Similar
Macro detail of pearlescent white heart acetate hair clip with French style engraving - White Mermaid
Elegant hollow heart acetate hair clip with pink marble texture on a ceramic plate - Pink Marble Pattern
French style hollow heart acetate hair clip with marble texture on ceramic plate - Spring Green
Elegant hollow heart-shaped acetate hair clip in deep red on a ceramic plate - Ancorra Red
+2
Hollow Heart Hair Clip Acetate Duckbill Side Clip French Style Marble Tortoise Shell Pattern Hair Accessory For Women
$0.98
No MOQ
Triangle Hair Claw Clip Acetate Acrylic Marble Tortoise Shell Geometric Hairpin Minimalist Japanese Style Elegant Hair
Triangle Hair Claw Clip Acetate Acrylic Marble Tortoise Shell Geometric Hairpin Minimalist Japanese Style Elegant Hair
like
Find Similar
Grey marble acetate triangle hair claw clip for women made of durable acrylic - Gray
Green marble triangular hair claw clip dimensions and acrylic material specifications - Light Green
Blue marble patterned triangular hair claw clip made of acrylic with dimensions of 8.8cm - Dark Blue
Minimalist triangular acrylic hair claw clip with brown tortoiseshell pattern details - Iridescent Green
+2
Triangle Hair Claw Clip Acetate Acrylic Marble Tortoise Shell Geometric Hairpin Minimalist Japanese Style Elegant Hair
$3.23
Mix MOQ : 2
Free Shipping
Flower Butterfly Hair Clips Duckbill Side Clips Fabric Alloy Faux Artificial Pearl Rhinestone For Women Wedding Party Beach Vacation
Flower Butterfly Hair Clips Duckbill Side Clips Fabric Alloy Faux Artificial Pearl Rhinestone For Women Wedding Party Beach Vacation
like
Find Similar
Romantic pink orchid hair clip accessory on model with elegant pearl necklace styling - 15# Purple Orchid
Pink gradient butterfly hair clip with gold accents and a white pearl pendant - 43# Pink Butterfly
Elegant blue butterfly hair clip and minimalist necklace set for summer beach vacations - 35# Blue Butterfly
Elegant blue butterfly hair clip with resin wings, sparkling rhinestones, and a pearl drop - 40# Blue Butterfly
+2
Flower Butterfly Hair Clips Duckbill Side Clips Fabric Alloy Faux Artificial Pearl Rhinestone For Women Wedding Party Beach Vacation
$1.11-1.41
No MOQ
Free Shipping
Large Hair Claw Clip Acetate French Style Nonslip Hairpin For Thick Hair Geometric Checkerboard Tortoise Shell Women
Large Hair Claw Clip Acetate French Style Nonslip Hairpin For Thick Hair Geometric Checkerboard Tortoise Shell Women
like
Find Similar
Elegant black glossy hair claw clip with gold lettering on a vintage pearl display - Black-12CM
Large amber tortoise shell acetate hair claw clip with golden France inscription - Mixed Brown-12CM
Elegant large red acetate hair claw clip with golden France inscription for thick hair - Red
Elegant large acetate hair claw clip with black and white polka dot pattern for thick hair - Black and White Dots-12CM
+2
NewLarge Hair Claw Clip Acetate French Style Nonslip Hairpin For Thick Hair Geometric Checkerboard Tortoise Shell Women
$3.03
No MOQ
Large Rectangular Hair Claw Clip Acrylic Iridescent Shell Pattern Hair Catch Barrette For Women Thick Hair Styling Accessories
Large Rectangular Hair Claw Clip Acrylic Iridescent Shell Pattern Hair Catch Barrette For Women Thick Hair Styling Accessories
like
Find Similar
Detailed view of iridescent hair claw clip with golden metal spring on white stone - Gray
Detail of pink gradient pearl finish hair claw clip with Barrette La France text - Pink
Detail of large iridescent rectangle hair claw clip with Barrette La France text - Pink Purple
Macro shot of large pink marble acetate hair claw clip with Barrette La France lettering - Orange
+2
Large Rectangular Hair Claw Clip Acrylic Iridescent Shell Pattern Hair Catch Barrette For Women Thick Hair Styling Accessories
-5%
$2.41
Mix MOQ : 2
Kids Knitted Elastic Headband Bohemian Multi Color Wave Pattern Twisted Hair Band For Girls Retro Outdoor Styling
Kids Knitted Elastic Headband Bohemian Multi Color Wave Pattern Twisted Hair Band For Girls Retro Outdoor Styling
like
Find Similar
Knitted wide headband featuring blue and white zigzag patterns with elastic back - Blue White Black Brown Wave
Fashionable woven wide headband featuring colorful multi-color stripes on white background - Multi-color Striped
Elastic knitted wide headband with colorful wavy patterns for women fashion styling - Purple Pink Gray Black Zigzag
Bohemian wide knitted headband with colorful geometric wave patterns and elastic band - Blue Red Orange Yellow Geometric
+2
Kids Knitted Elastic Headband Bohemian Multi Color Wave Pattern Twisted Hair Band For Girls Retro Outdoor Styling
-5%
$1.31
Mix MOQ : 2
Geometric Acetate Hair Claw Clip Leopard Print Tortoise Shell Retro Hair Accessories For Women
Geometric Acetate Hair Claw Clip Leopard Print Tortoise Shell Retro Hair Accessories For Women
like
Find Similar
Detail of a chic leopard print hair claw clip reflected on a heart-shaped mirror base - Leopard Beige-Black
Macro detail of amber tortoiseshell claw clip on a white heart mirror setting - Amber
Macro view of checkered pattern hair claw clip on heart-shaped mirror tray - Checkered
Detail view of champagne acetate hair claw on heart mirror with smooth pearly texture - Marble Pink
+2
Geometric Acetate Hair Claw Clip Leopard Print Tortoise Shell Retro Hair Accessories For Women
$0.80
No MOQ
Korean Style Gradient Plumeria Flower Hair Claw Clip Sweet Resin Glitter Shark Clip Women Beach Hair Accessories
Korean Style Gradient Plumeria Flower Hair Claw Clip Sweet Resin Glitter Shark Clip Women Beach Hair Accessories
like
Find Similar
Detail view of purple gradient flower hair claw with glitter finish and resin texture - Purple
Detailed top view of a blue gradient flower hair claw clip with a resin finish - Sky Blue
Close-up of frangipani hair claw clip with orange gradient petals and pearlescent finish - Orange
Detailed close-up of a plumeria hair claw clip with green and white gradient resin petals - Light Green
+2
Korean Style Gradient Plumeria Flower Hair Claw Clip Sweet Resin Glitter Shark Clip Women Beach Hair Accessories
$0.80
No MOQ
Korean Style Acetate Seamless Hair Clips Women Vintage Tortoise Shell Marble Duckbill Clips Hair Styling Accessories
Korean Style Acetate Seamless Hair Clips Women Vintage Tortoise Shell Marble Duckbill Clips Hair Styling Accessories
like
Find Similar
Macro detail of the pale green acetate resin finish and gold alligator clip base - 6cm / Metallic Green
Detail of a purple and blue gradient acetate hair clip with a gold metal spring clasp - 6cm / Dreamy Purple
Macro view of cream acetate hair clip with polished golden metal clamp detail - 6cm / Shell White
Detailed macro view of the purple and blue marble pattern acetate hair clip with gold metal base - 6cm / Floral Purple
+2
Korean Style Acetate Seamless Hair Clips Women Vintage Tortoise Shell Marble Duckbill Clips Hair Styling Accessories
$0.37
Mix MOQ : 36
Sweet Flower Petal Hair Claw Clip Small Gradient Plastic Shark Clip For Women Girls Summer Beach Hair Accessories
Sweet Flower Petal Hair Claw Clip Small Gradient Plastic Shark Clip For Women Girls Summer Beach Hair Accessories
like
Find Similar
4cm heart petal flower claw clip in creamy white with orange center gradient finish - White
Blue and yellow gradient flower hair claw clip with 4cm heart petal design for women - Blue
Pink gradient floral hair claw clip in a sweet flower design with 4cm size - Pink
Pink gradient flower hair claw clip with 4cm heart petals and transparent teeth - Red
+2
Sweet Flower Petal Hair Claw Clip Small Gradient Plastic Shark Clip For Women Girls Summer Beach Hair Accessories
$0.29
Mix MOQ : 2
Gradient Frangipani Hair Claw Clip Resin Flower Hairpin Summer Beach Vacation Accessories For Women Sweet Floral Hair Catch Barrette
Gradient Frangipani Hair Claw Clip Resin Flower Hairpin Summer Beach Vacation Accessories For Women Sweet Floral Hair Catch Barrette
like
Find Similar
Gradient pink frangipani flower hair claw clip displayed on a white ceramic jewelry tray - Gradient Red
Translucent red floral hair claw clip in plumeria shape for beach vacation styling - Cherry Red
Elegant brick red frangipani flower hair claw clip with a glossy resin finish - Orange Red
Pink and orange gradient frangipani flower hair claw clip with transparent resin finish - Light Watermelon Red
+3
Gradient Frangipani Hair Claw Clip Resin Flower Hairpin Summer Beach Vacation Accessories For Women Sweet Floral Hair Catch Barrette
$0.33
No MOQ
Summer Beach Flower Hair Claw Clip Large Resin Gradient Frangipani Hair Clip For Women Vacation Style Hair Accessory
Summer Beach Flower Hair Claw Clip Large Resin Gradient Frangipani Hair Clip For Women Vacation Style Hair Accessory
like
Find Similar
Detail of yellow flower hair claw clip with translucent jelly texture on a white plate - Yellow
Detailed macro view of a large gradient pink resin flower claw clip with realistic petals - Rose Red
Detailed view of blue hibiscus flower hair claw with yellow center and resin petals - Blue
Macro detail of a large purple gradient plumeria hair claw clip on a white plate - Purple
+3
Summer Beach Flower Hair Claw Clip Large Resin Gradient Frangipani Hair Clip For Women Vacation Style Hair Accessory
$0.69
No MOQ
Ocean Series Imitation Acetate Hair Claw Iridescent Gradient Blue Dolphin Starfish Shell Fishbone Shark Clip Hair Accessories
Ocean Series Imitation Acetate Hair Claw Iridescent Gradient Blue Dolphin Starfish Shell Fishbone Shark Clip Hair Accessories
like
Find Similar
Fishbone hair claw clip with blue and purple gradient finish for ocean style - Fishbone
Ocean series fish bone hair claw clip in purple and blue gradient marble finish - Hollow Fish
Gradient blue dolphin hair claw clip with pearlescent finish in ocean style - Dolphin
Pearlescent light blue shell hair claw clip with ocean gradient finish for women - Shell
+2
Ocean Series Imitation Acetate Hair Claw Iridescent Gradient Blue Dolphin Starfish Shell Fishbone Shark Clip Hair Accessories
-4%
$1.78
No MOQ
French Style Cellulose Acetate Heart Hair Clip Mini Hollow Hair Claw For Women Elegant Tortoise Shell Marble Hair Accessories
French Style Cellulose Acetate Heart Hair Clip Mini Hollow Hair Claw For Women Elegant Tortoise Shell Marble Hair Accessories
like
Find Similar
Elegant heart-shaped acetate hair claw clip with pearlescent white finish and gold logo - Pearlescent White Mini Hollow Heart
Elegant emerald marble acetate heart hair claw clip with golden handmade logo - Transparent Green Mini Hollow Heart
Macro detail of heart-shaped marble acetate hair claw with golden handmade text - Custard Yellow Mini Hollow Heart
Detail of a handmade heart-shaped acetate hair claw clip with amber tortoise shell pattern - Coffee Brown Mini Hollow Heart
+2
French Style Cellulose Acetate Heart Hair Clip Mini Hollow Hair Claw For Women Elegant Tortoise Shell Marble Hair Accessories
$1.30
No MOQ
Free Shipping
Frangipani Flower Hair Claw Clip Transparent Gradient Resin Hair Accessory For Women Beach Vacation Style Elegant Hair Clip
Frangipani Flower Hair Claw Clip Transparent Gradient Resin Hair Accessory For Women Beach Vacation Style Elegant Hair Clip
like
Find Similar
Translucent smoky grey plumeria hair claw clip with elegant floral petal design - Transparent Black Center
Deep blue gradient plumeria flower hair claw clip in a white ceramic tray - Transparent Gradient Black
Pink and green gradient frangipani flower hair claw clip on a white decorative tray - Green Base Pink Center
Translucent red plumeria hair claw clip with glossy resin finish for vacation - Transparent Red
+7
Frangipani Flower Hair Claw Clip Transparent Gradient Resin Hair Accessory For Women Beach Vacation Style Elegant Hair Clip
$0.36
No MOQ
Vintage Titanium Steel Ocean Starfish Shell Hair Clip Elegant Gold Artificial Pearl Headwear For Women Daily Dating Hair Jewelry
Vintage Titanium Steel Ocean Starfish Shell Hair Clip Elegant Gold Artificial Pearl Headwear For Women Daily Dating Hair Jewelry
like
Find Similar
Macro view of gold ginkgo leaf hair clip showing 76mm length and 45mm width specs - Ginkgo Leaf Shape / Gold Style 1
Close-up of golden metal hair clip with hammer texture and hollow design measuring 77mm - Hammered Hollow Style / Gold Style 2
Detail of golden shell hair clip with pearls and clip mechanism dimensions 61mm - Shell Pearl Inlay Style / Gold Style 3
Detailed view of 18K gold rectangle hair clip with spiral motif and 69mm length dimensions - Rectangular Spiral Shape / Gold Style 4
+6
Vintage Titanium Steel Ocean Starfish Shell Hair Clip Elegant Gold Artificial Pearl Headwear For Women Daily Dating Hair Jewelry
$5.16
Mix MOQ : 3
Free Shipping
French Minimalist U-Shaped Cellulose Acetate Hair Stick Tortoise Shell Marble Pattern Hairpin For Women Daily Updo Styling Tool Accessory
French Minimalist U-Shaped Cellulose Acetate Hair Stick Tortoise Shell Marble Pattern Hairpin For Women Daily Updo Styling Tool Accessory
like
Find Similar
Detail view of a 10.5cm acetate U-shaped hair pin with a brown tortoiseshell leopard pattern - Dark Tortoise Shell
Length measurement of U-shaped acetate hair pin with marble pattern showing 10.5cm on a ruler - Light Tortoise Shell
Detailed view of U-shaped hair pin with tortoiseshell pattern and 11cm scale measurement - Yellow Floral Pattern
Detailed view of an 11.5cm tortoiseshell acetate U-shaped hair pin on a scale - Black Multi-color Pattern
+6
French Minimalist U-Shaped Cellulose Acetate Hair Stick Tortoise Shell Marble Pattern Hairpin For Women Daily Updo Styling Tool Accessory
-5%
$1.23
Mix MOQ : 2
Free Shipping
Sweet Simulated Fabric Flower Hair Clip For Women Seaside Beach Holiday Style Hibiscus Lily Poppy Flower Hair Accessories
Sweet Simulated Fabric Flower Hair Clip For Women Seaside Beach Holiday Style Hibiscus Lily Poppy Flower Hair Accessories
like
Find Similar
Sweet light purple frangipani hair clip with realistic fabric petals and white stamen - Lily Flower Purple
Pink artificial lily flower hair clip with realistic gradient petals and stamen details - Lily Pink
Silk red artificial lily flower hair clip for beach vacation hair styling accessories - Lily Red
Yellow hibiscus flower hair clip with realistic petals for beach vacation style - Yellow Hibiscus Hair Clip
+6
NewSweet Simulated Fabric Flower Hair Clip For Women Seaside Beach Holiday Style Hibiscus Lily Poppy Flower Hair Accessories
-6%
$0.23-0.36
No MOQ
French Vintage Acetate Hair Claw Clip Elegant Tortoise Shell Marble Pattern Shark Clip For Women Fashion Hair Accessories
French Vintage Acetate Hair Claw Clip Elegant Tortoise Shell Marble Pattern Shark Clip For Women Fashion Hair Accessories
like
Find Similar
Classic dark amber tortoiseshell acetate medium hair claw clip in resin finish - Dark Coffee
Glossy black acetate hair claw clip with a chic cross twist design and gold logo - Black
Classic pearlescent white acetate hair claw clip with twisted ribbon design for women - White
Classic amber tortoiseshell acetate hair claw clip for elegant half-up hairstyles - Dark Tortoiseshell
+6
French Vintage Acetate Hair Claw Clip Elegant Tortoise Shell Marble Pattern Shark Clip For Women Fashion Hair Accessories
$2.33
No MOQ
Free Shipping
Elegant French Vintage Acetate Hair Clip Simple Long Spindle Shape Hairpin Marble Tortoise Shell Barrette For Women Daily Accessories
Elegant French Vintage Acetate Hair Clip Simple Long Spindle Shape Hairpin Marble Tortoise Shell Barrette For Women Daily Accessories
like
Find Similar
Detailed macro view of red willow leaf acetate hair clip with gold handmade lettering - Red
Close-up of olive green acetate hair clip with France Handmade gold engraving - Green
Close-up of blue marbled acetate spindle hair clip with France Handmade engraving - Ink Wash Blue
Detailed close-up of iridescent acetate leaf hair clip with France Handmade marking - Mermaid Color
+6
Elegant French Vintage Acetate Hair Clip Simple Long Spindle Shape Hairpin Marble Tortoise Shell Barrette For Women Daily Accessories
$0.63
No MOQ
Mini Hair Claw Clips Cellulose Acetate Handmade French Style Vintage Tortoise Shell Marble Pattern Women Girls Hair Styling Accessory
Mini Hair Claw Clips Cellulose Acetate Handmade French Style Vintage Tortoise Shell Marble Pattern Women Girls Hair Styling Accessory
like
Find Similar
Detailed close-up of mini tortoiseshell acetate hair claw clip with gold handmade engraving - Lake Blue Brown
Close-up of tortoise shell pattern acetate hair claw with France handmade gold text - Dark Coffee Pattern
Close-up of a small spotted acetate hair claw with France Handmade gold engraving - Black and White Dots
Detailed close-up of marble pattern acetate hair claw clip with France handmade gold lettering - Pink Green Floral
+6
Mini Hair Claw Clips Cellulose Acetate Handmade French Style Vintage Tortoise Shell Marble Pattern Women Girls Hair Styling Accessory
$0.58
No MOQ
Free Shipping
Elegant Bow Hair Claw Clip For Women Korean Style Large PC Tortoise Shell Shark Clip Matte Glossy Hair Accessories Strong Hold Hairgrip
Elegant Bow Hair Claw Clip For Women Korean Style Large PC Tortoise Shell Shark Clip Matte Glossy Hair Accessories Strong Hold Hairgrip
like
Find Similar
Macro shot of elegant cream butterfly hair claw clip with golden metal spring - Brown
Detailed top view of a glossy tortoiseshell resin bow hair claw clip on grey background - Bright Amber
Elegant deep brown glossy bow hair claw clip with a secure golden metal spring - Chocolate
Elegant tortoiseshell pattern bow hair claw clip with glossy resin finish for women - Matte Amber
+6
Elegant Bow Hair Claw Clip For Women Korean Style Large PC Tortoise Shell Shark Clip Matte Glossy Hair Accessories Strong Hold Hairgrip
$1.15
No MOQ
Women Nautical Knotted Headband With Artificial Pearls Starfish Shell Decorations Fabric Handmade Wide Hair Band Accessory
Women Nautical Knotted Headband With Artificial Pearls Starfish Shell Decorations Fabric Handmade Wide Hair Band Accessory
like
Find Similar
Close-up of cream fabric knotted headband with white pearls and blue starfish charms - Beige
Close-up of pink knotted headband with white pearls, blue resin starfish and shell charms - Pink
Detailed view of purple fabric headband with starfish, white pearls and sea shells - Purple
Women Nautical Knotted Headband With Artificial Pearls Starfish Shell Decorations Fabric Handmade Wide Hair Band Accessory
$2.36
No MOQ
Bohemian Linen Woven Hollow Out Wide Headband For Women Summer Vacation Beach Straw Knit Hair Accessories Sweet Headband
Bohemian Linen Woven Hollow Out Wide Headband For Women Summer Vacation Beach Straw Knit Hair Accessories Sweet Headband
like
Find Similar
Detail of bohemian hand-woven linen headband featuring white lace hollow patterns - Forest Retro Straw Lace Hollow Style (A款)
Bohemian beige linen woven hollow-out wide headband for a vintage vacation style - Bohemian Hollow Mesh Beige Style (B款)
Bohemian hand-woven linen headband with hollow geometric pattern in natural khaki color - Handmade Crochet Geometric Pattern Khaki Style (C款)
Bohemian Linen Woven Hollow Out Wide Headband For Women Summer Vacation Beach Straw Knit Hair Accessories Sweet Headband
-5%
$0.74
No MOQ
Ocean Series Starfish Fish Pattern Acrylic Hair Claw Clip For Women Fashion Simple Summer Beach Hair Accessories Shark Clip
Ocean Series Starfish Fish Pattern Acrylic Hair Claw Clip For Women Fashion Simple Summer Beach Hair Accessories Shark Clip
like
Find Similar
Pink marbled starfish hair claw clip with colorful ocean fish print and acrylic finish - Pink 7.8cm
Starfish and fish print hair claw clip in pearl white acrylic for ocean style - White 7.8cm
Starfish and fish pattern acrylic hair claw clip in pearlescent pale yellow finish - Yellow 7.8cm
Blue translucent starfish hair claw clip with golden glitter and fish pattern print - Blue 7.8cm
+2
Ocean Series Starfish Fish Pattern Acrylic Hair Claw Clip For Women Fashion Simple Summer Beach Hair Accessories Shark Clip
$1.87
Mix MOQ : 6
Free Shipping
Toddler Kids Knit Bow Headband Flower Sunglasses For Girls Summer Outdoor Beach Travel Fashion Headwear Eyewear Jewelry
Toddler Kids Knit Bow Headband Flower Sunglasses For Girls Summer Outdoor Beach Travel Fashion Headwear Eyewear Jewelry
like
Find Similar
Detailed set of light blue baby nylon headband with large bow and daisy round sunglasses - 14*14cm / Blue
Detail of baby headband with knit bow and daisy sunglasses on a white display card - 14*14cm / Beige
Pink bow headband and daisy floral sunglasses 2-piece set for baby girls' summer sun protection - 14*14cm / Pink
Close-up of pink baby bow headband and sunglasses with floral detail on display card - 14*14cm / Dusty Pink
+2
Toddler Kids Knit Bow Headband Flower Sunglasses For Girls Summer Outdoor Beach Travel Fashion Headwear Eyewear Jewelry
$1.99
Mix MOQ : 2
Gradient Plumeria Flower Hair Claw Clip Acrylic Resin Shark Hair Accessory For Women Summer Beach Vacation
Gradient Plumeria Flower Hair Claw Clip Acrylic Resin Shark Hair Accessory For Women Summer Beach Vacation
like
Find Similar
Detail view of a frangipani hair claw clip with blue and yellow gradient resin petals - Light Blue
Close-up of translucent purple gradient frangipani flower hair claw clip with glossy finish - Purple
Macro view of a realistic orange gradient plumeria hair claw clip on a white desk - Orange
Close-up of translucent orange gradient flower hair claw clip with stable resin teeth - Red
+2
Gradient Plumeria Flower Hair Claw Clip Acrylic Resin Shark Hair Accessory For Women Summer Beach Vacation
$0.24
Mix MOQ : 2
Elegant Acetate Geometric Rectangular Hair Claw Clip Large Metal Spring Shark Clip Marble Tortoise Shell Hair Accessories For Women
Elegant Acetate Geometric Rectangular Hair Claw Clip Large Metal Spring Shark Clip Marble Tortoise Shell Hair Accessories For Women
like
Find Similar
Elegant cream white acetate hair claw clip with golden metal teeth for women - Mermaid Iridescent (Gold Clip)
Elegant white acetate hair claw clip for women featuring a minimalist square cutout design - Mermaid Iridescent (Silver Clip)
Detailed view of rectangle amber marble hair claw clip with golden metal spring on canvas - Orange Blue
Detail of a rectangular hollow hair claw clip with black and white marble pattern and gold spring - Cow Pattern
+4
Elegant Acetate Geometric Rectangular Hair Claw Clip Large Metal Spring Shark Clip Marble Tortoise Shell Hair Accessories For Women
-4%
$2.68
No MOQ
Mini Acetate Hair Claw Clips Elegant Leopard Tortoise Shell Marble Patterns For Women French Vintage Style Hairpins Hair Clip
Mini Acetate Hair Claw Clips Elegant Leopard Tortoise Shell Marble Patterns For Women French Vintage Style Hairpins Hair Clip
like
Find Similar
Mini acetate hair claw clip in creamy white finish for small sections and bangs - Mermaid Pearlescent Style / 3cm
Mini acetate hair claw clip featuring elegant brown and beige marble tortoiseshell pattern - Colored Brown Marble / 3cm
Classic tortoiseshell acetate hair claw clip for bangs and high ponytail styling - Beige Tortoiseshell Style / 3cm
Mini acetate hair claw clip with tortoise shell pattern and glossy finish for bangs - Coffee Tortoiseshell Style / 3cm
+4
Mini Acetate Hair Claw Clips Elegant Leopard Tortoise Shell Marble Patterns For Women French Vintage Style Hairpins Hair Clip
$0.98
Mix MOQ : 12
Free Shipping
French Vintage Cellulose Acetate Hair Claw Clip Hollow Oval Tortoise Shell Marble Cow Print Hair Styling Accessory For Women
French Vintage Cellulose Acetate Hair Claw Clip Hollow Oval Tortoise Shell Marble Cow Print Hair Styling Accessory For Women
like
Find Similar
Retro french acetate hair claw clip with colorful tortoiseshell marble patterns - Small / Orange Yellow Small Floral
Close-up of marble pattern acetate hair claw clip with blue and grey swirl textures - Small / Grey Blue
Close-up of tortoise shell pattern acetate hair claw clip with oval shape and glossy finish - Small / Coffee Tortoise Shell
French retro acetate hair claw clip with beige and black tortoiseshell leopard pattern - Small / Tortoise
+4
French Vintage Cellulose Acetate Hair Claw Clip Hollow Oval Tortoise Shell Marble Cow Print Hair Styling Accessory For Women
$1.24
Mix MOQ : 12
Free Shipping
French Style Cellulose Acetate Duckbill Hair Clip Irregular Oval Bangs Side Clip Tortoise Shell Hair Accessories Women
French Style Cellulose Acetate Duckbill Hair Clip Irregular Oval Bangs Side Clip Tortoise Shell Hair Accessories Women
like
Find Similar
Close-up of tortoise shell acetate hair clip with gold France Handmade lettering - Dark Coffee Magic
Detailed macro view of marbled acetate hair clip with brown and cream textures - Khaki Color
Detailed view of amber acetate hair clip with polished finish on beige linen backdrop - Dark Coffee
Detail of tortoise shell acetate hair clip with FRANCE Handmade engraving text - Light Coffee
+4
French Style Cellulose Acetate Duckbill Hair Clip Irregular Oval Bangs Side Clip Tortoise Shell Hair Accessories Women
$1.04
No MOQ
Free Shipping
Go to

More in accessories

Explore more in summer theme hair accessories

clawgirlshairpinhandmadepartyponytailgeometricwidehearthollow
resinartificialplasticmetaldailywovenbandresin hairgold platedpolyester

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access