Everful

Wholesale summer theme hair accessories

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Summer Theme Hair Accessories

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in summer theme hair accessories

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Gold Alloy Ocean Theme Hair Clips With Faux Artificial Pearls And Rhinestones Shell Starfish Conch Shape Elegant Hair Accessories For Women
Gold Alloy Ocean Theme Hair Clips With Faux Artificial Pearls And Rhinestones Shell Starfish Conch Shape Elegant Hair Accessories For Women
like
Find Similar
Golden hollow shell hair clip with white pearls and rhinestones on a white background - Pearl Shell / Gold
Golden starfish and shell hair clip with pearls and rhinestones on a white background - Starfish Shell / Gold
Golden starfish shell hair clip with white faux pearls and rhinestones on white background - Conch / Gold
Gold Alloy Ocean Theme Hair Clips With Faux Artificial Pearls And Rhinestones Shell Starfish Conch Shape Elegant Hair Accessories For Women
-5%
$0.65
No MOQ
Elegant Alloy Flower Shell Shape Hair Claw Clips Metal Shark Hairpins Strong Hold Fashion Hair Accessories For Women
Elegant Alloy Flower Shell Shape Hair Claw Clips Metal Shark Hairpins Strong Hold Fashion Hair Accessories For Women
like
Find Similar
Elegant silver metal flower hair claw clip with mirror finish on a brown leather texture - Large Flower Claw / Silver
Golden flower-shaped metal hair claw clip with polished finish for thick hair - Large Flower Claw / Gold
Golden flower-shaped metal hair claw clip for thick hair shown on a white background - Small Flower Claw / Gold
Detailed view of a golden shell-shaped metal hair claw clip with a polished finish - Large Shell Claw / Gold
+2
Elegant Alloy Flower Shell Shape Hair Claw Clips Metal Shark Hairpins Strong Hold Fashion Hair Accessories For Women
-5%
$0.90-2.20
No MOQ
Metal Shell Hair Claw Clip Plated Fan Shape Updo Hairpins For Women Fashion Accessories Elegant Hair Grips
Metal Shell Hair Claw Clip Plated Fan Shape Updo Hairpins For Women Fashion Accessories Elegant Hair Grips
like
Find Similar
Detailed view of a gold-plated shell-shaped metal hair claw clip with elegant hollow design - Electroplated Gold
Detailed view of silver metallic scallop shell hair claw clip held by a gloved hand - Electroplated Silver
Close-up of a gold-plated scalloped hair claw clip with a hollow shell design - Electroplated Rose Gold
Detail of a sleek black fan-shaped metallic hair claw clip held with white gloves - Electroplated Gun Black
Metal Shell Hair Claw Clip Plated Fan Shape Updo Hairpins For Women Fashion Accessories Elegant Hair Grips
$0.40
Mix MOQ : 2
Hair Clips For Women Stainless Steel Gold Plated Shell Bow Flower Design Elegant Hairpin Styling Accessories Fashion
Hair Clips For Women Stainless Steel Gold Plated Shell Bow Flower Design Elegant Hairpin Styling Accessories Fashion
like
Find Similar
Golden bow hair clip detail with dimensions showing 6.0cm length and 12.7g weight - Gold Bowknot
Detailed view of scallop-shaped gold hair clip with dimensions and 16.2g weight specs - Golden Shell
Silver shell-shaped metal hair clip measuring 6.5cm by 2.93cm with 16.2g weight - Silver Shell
Detailed view of gold flower hair clip with size 3.66cm and weight 7.9g specifications - Gold Flower (NMSH-G513-2)
Hair Clips For Women Stainless Steel Gold Plated Shell Bow Flower Design Elegant Hairpin Styling Accessories Fashion
-5%
$3.15-4.52
No MOQ
Free Shipping
Iridescent Flower Hair Claw Clip With Rhinestone Acetate Texture Shell Luster Shark Clip Hair Accessories For Women Hair Clip
Iridescent Flower Hair Claw Clip With Rhinestone Acetate Texture Shell Luster Shark Clip Hair Accessories For Women Hair Clip
like
Find Similar
Macro shot of pink floral hair claw clip with pearl texture and crystal on wood - Large - Iridescent Yellow
Close-up of elegant pink pearlescent flower hair claw clip with crystal drop accent - Large - Iridescent Purple
Macro shot of a shimmering sky blue floral hair claw clip on a rustic wooden tray - Large - Iridescent Teal
Macro shot of a floral acetic acid hair claw with pearlescent pink texture and drop diamond - Large - Iridescent Pink
+8
Iridescent Flower Hair Claw Clip With Rhinestone Acetate Texture Shell Luster Shark Clip Hair Accessories For Women Hair Clip
$1.25-1.93
No MOQ
Free Shipping
Iridescent Plumeria Flower Hair Claw Clip Sweet Hawaiian Frangipani Hair Accessory For Women Girls Beach Vacation Gift
Iridescent Plumeria Flower Hair Claw Clip Sweet Hawaiian Frangipani Hair Accessory For Women Girls Beach Vacation Gift
like
Find Similar
Floral frangipani hair claw clip with pearly white and blue gradient finish - Green - Triple Flower Style
Chic pearlescent gradient blue frangipani flower hair claw clip with a glossy finish - Green - Single Flower Style
Iridescent plumeria flower hair claw clip with triple blossoms and pearlescent finish - Yellow - Triple Flower Style
Colorful three-flower plumeria hair claw clip with pearlescent finish and white petals - Purple - Triple Flower Style
+8
Iridescent Plumeria Flower Hair Claw Clip Sweet Hawaiian Frangipani Hair Accessory For Women Girls Beach Vacation Gift
$0.57-0.62
No MOQ
Summer Ocean Style Whale Conch Shell Hair Claw Clips Acetate Marble Rhinestone Shark Hair Clips For Women Hair Accessories
Summer Ocean Style Whale Conch Shell Hair Claw Clips Acetate Marble Rhinestone Shark Hair Clips For Women Hair Accessories
like
Find Similar
Blue whale hair claw clip with pearl texture and rhinestones for summer ocean style - Blue Whale
Light blue whale hair claw clip with pearlescent finish and sparkling rhinestone details - Cyan Whale
Pink translucent whale hair claw clip with rhinestones and summer ocean wave elements - Pink Whale
Pearlescent white whale hair claw clip with rhinestones for summer ocean style hair - Creamy White Whale
+8
Summer Ocean Style Whale Conch Shell Hair Claw Clips Acetate Marble Rhinestone Shark Hair Clips For Women Hair Accessories
-5%
$1.45
No MOQ
Fashion Acrylic Geometric Hollow Hair Claw Clips For Women Shell Texture Resin Shark Clips Elegant Hairpin Hair Accessories
Fashion Acrylic Geometric Hollow Hair Claw Clips For Women Shell Texture Resin Shark Clips Elegant Hairpin Hair Accessories
like
Find Similar
Square acrylic hair claw in translucent purple with embedded shell fragments - 5cm / Dreamy Purple
Transparent acrylic hair claw with orange and lilac floral inserts in geometric design - 5cm / Orange Yellow
Square acrylic hair claw clip with black stone texture on a reflective surface - 5cm / Carbon Black
Pink translucent acrylic hair claw clip with embedded glitter and hollow geometric design - 5cm / Sakura Pink
+8
Fashion Acrylic Geometric Hollow Hair Claw Clips For Women Shell Texture Resin Shark Clips Elegant Hairpin Hair Accessories
-4%
$0.99-1.18
No MOQ
Summer Beach Style Iridescent Conch ABS Hair Claw Clip Large Sea Snail Shape Shark Clip For Women Vacation Hair Accessory
Summer Beach Style Iridescent Conch ABS Hair Claw Clip Large Sea Snail Shape Shark Clip For Women Vacation Hair Accessory
like
Find Similar
Iridescent white conch shell hair claw clip with a pearlescent finish for summer hair styles - Conch 1
Vibrant green and blue gradient conch-shaped hair claw clip with a glossy finish - Conch 2
Iridescent conch hair claw clip in gradient metallic colors for elegant summer hair styling - Conch 3
Conch shaped hair claw clip with colorful pink and orange pearlescent gradient finish - Conch 4
+9
Summer Beach Style Iridescent Conch ABS Hair Claw Clip Large Sea Snail Shape Shark Clip For Women Vacation Hair Accessory
-5%
$1.31
No MOQ
Elegant Shell Shape Acetate Hair Claw Clip With Rhinestone Ocean Style Gold Foil Line Shark Clip For Women Hair Accessories
Elegant Shell Shape Acetate Hair Claw Clip With Rhinestone Ocean Style Gold Foil Line Shark Clip For Women Hair Accessories
like
Find Similar
Elegant cream shell hair claw clip with gold accents and sparkling rhinestones - White
Close-up of shell-shaped acetate hair claw with iridescent finish and rhinestone accents - Gray
Pink shell-shaped hair claw clip with golden accents and sparkling rhinestones - Pink
Macro shot of seashell hair claw clip with gold lines and rhinestones on shell plate - Green
+1
NewElegant Shell Shape Acetate Hair Claw Clip With Rhinestone Ocean Style Gold Foil Line Shark Clip For Women Hair Accessories
$2.25
No MOQ
Free Shipping
Iridescent Acetate Hair Claw Clip For Women Large Geometric Hollow Hair Clamps Korean Style Tortoise Shell Shark Clip Accessories
Iridescent Acetate Hair Claw Clip For Women Large Geometric Hollow Hair Clamps Korean Style Tortoise Shell Shark Clip Accessories
like
Find Similar
Detail of a beige iridescent hair claw clip with cutout design on a wooden tray - Iridescent Yellow
Detailed macro view of pink marble acetate hair claw clip with colorful pearlescent finish - Metallic Purple
Detail shot of light blue marble acetate hair claw clip with cutout rectangular design - Iridescent Blue Green
Macro shot of an elegant pink marble acetate hair claw clip on a light wooden tray - Metallic Pink
+8
Iridescent Acetate Hair Claw Clip For Women Large Geometric Hollow Hair Clamps Korean Style Tortoise Shell Shark Clip Accessories
$1.59-1.67
No MOQ
Rectangular Acetate Hair Claw Clips Large Geometric Hollow Marble Tortoise Shell Pattern Fashion Hair Accessories For Women
Rectangular Acetate Hair Claw Clips Large Geometric Hollow Marble Tortoise Shell Pattern Fashion Hair Accessories For Women
like
Find Similar
Detail shot of the 8.2cm rectangular tortoise shell hair claw with golden spring - Bulk Packaging / Leopard Print
8.2CM marble blue acetate hair claw clip with rectangle hollow design and metal spring - Bulk Packaging / Green Stripe Marble
Detail of 8.2cm acetate hair claw clip showing elegant cream marble texture and spring - Bulk Packaging / Beige Stripe Marble
Macro view of 8.2cm acetate hair claw clip showing pink and blue marble texture - Bulk Packaging / Light Pink Blue Marble
+6
Rectangular Acetate Hair Claw Clips Large Geometric Hollow Marble Tortoise Shell Pattern Fashion Hair Accessories For Women
$1.30-1.41
No MOQ
 · 
14 views
Mini Acetate Shell Hair Claw Clip With Marble Pattern And Gold Glitter Scallop Hairpin For Women Sweet Hair Accessories
Mini Acetate Shell Hair Claw Clip With Marble Pattern And Gold Glitter Scallop Hairpin For Women Sweet Hair Accessories
like
Find Similar
Detail of a shell-shaped acetate hair claw with pink pearlescent finish and gold glitter lines - White
Close-up of shell-shaped pink hair clip with gold glitter details on neutral background - Orange
Macro detail of mint green acetate shell hair claw with golden glitter pattern and texture - Green
Macro detail of mini shell hair clip with blue pink marble texture and gold lines - Blue
+6
Mini Acetate Shell Hair Claw Clip With Marble Pattern And Gold Glitter Scallop Hairpin For Women Sweet Hair Accessories
$0.60-1.48
No MOQ
Free Shipping
Trendy Tortoise Shell Pattern Headband Resin Non Slip Hair Hoop For Women Vintage Fashion Hair Accessories
Trendy Tortoise Shell Pattern Headband Resin Non Slip Hair Hoop For Women Vintage Fashion Hair Accessories
like
Find Similar
Detail of tortoiseshell wavy headband with comb teeth held by hand for non-slip hair styling - Amber Wave Hairband
Minimalist black wavy headband in glasses frame style for hair styling and washing face - Black Eyeglass Hairband
Dark brown wavy toothed headband for women with non-slip plastic grip for face washing - Black Coffee Wave Hairband
Amber wide tortoiseshell hairband with 3.5cm width for high cranial top hair styling - Amber Eyeglass Hairband
+5
Trendy Tortoise Shell Pattern Headband Resin Non Slip Hair Hoop For Women Vintage Fashion Hair Accessories
$0.40-1.07
No MOQ
French Vintage Acetate Ocean Shell Hollow Hair Claw For Women Marbled Leopard Floral Shark Clip Versatile Hair Styling Accessories
French Vintage Acetate Ocean Shell Hollow Hair Claw For Women Marbled Leopard Floral Shark Clip Versatile Hair Styling Accessories
like
Find Similar
Close-up of hollow shell hair claw clip with colorful marble acetate texture on shell tray - Iridescent Blue Pink
Macro shot of tortoise shell pattern acetate hair claw clip on white shell tray decor - Light Leopard
Detail of tortoiseshell patterned acetate hair claw clip on white textured tray - Dark Leopard
Macro detail of gradient acetate shell hair claw clip with cutout design and spring - Iridescent Blue Purple
+5
French Vintage Acetate Ocean Shell Hollow Hair Claw For Women Marbled Leopard Floral Shark Clip Versatile Hair Styling Accessories
$2.02
No MOQ
Free Shipping
Vintage Acetate Hair Claw Clip Geometric Square Hollow Tortoise Shell Marble Pattern Nonslip Hair Clamp Accessory For Women
Vintage Acetate Hair Claw Clip Geometric Square Hollow Tortoise Shell Marble Pattern Nonslip Hair Clamp Accessory For Women
like
Find Similar
Detailed view of a square marble texture hair claw clip with warm decorative accents - 8# Pink Grey Cloud Marble
Macro detail of tortoiseshell acetate claw clip with a hollow rectangular design - 5# Hollow Amber Tortoise
Macro view of cream marble acetate hair claw clip with pearlescent finish and square shape - 4# Cream Pearl Marble
Macro shot of square acetate hair claw with champagne marble texture and metal spring - 3# Champagne Marble
+4
Vintage Acetate Hair Claw Clip Geometric Square Hollow Tortoise Shell Marble Pattern Nonslip Hair Clamp Accessory For Women
$1.53
Mix MOQ : 3
Stainless Steel Hair Clips 18K Gold Plated Artificial Pearl Rhinestone Flower Starfish Shell Butterfly Hairpins Women Elegant
Stainless Steel Hair Clips 18K Gold Plated Artificial Pearl Rhinestone Flower Starfish Shell Butterfly Hairpins Women Elegant
like
Find Similar
Detail of 18K gold starfish and pearl hair clip showing dimensions 6cm and 1.2cm - Three Starfish Pearl Style (HC-H60026) / Gold
Detailed size specifications of 18K gold stainless steel double butterfly hair clip - Double Butterfly Style (HC-H60027) / Gold
Detailed dimensions of a shell-shaped 18K gold-plated stainless steel hair clip - Double Shell Style (HC-H60028) / Gold
Detailed dimensions of the gold semi-circular stainless steel hair clip on white background - Semi-spherical Style (HC-H60030) / Gold
+4
Stainless Steel Hair Clips 18K Gold Plated Artificial Pearl Rhinestone Flower Starfish Shell Butterfly Hairpins Women Elegant
$2.88-4.90
No MOQ
Free Shipping
Large Hair Claw Clips Plastic Resin Matte Glossy Rectangle Heart Shape Tortoise Shell Elegant Hair Styling Accessories For Women
Large Hair Claw Clips Plastic Resin Matte Glossy Rectangle Heart Shape Tortoise Shell Elegant Hair Styling Accessories For Women
like
Find Similar
Close-up of large glossy black acetate hair claw clip with rectangular hollow design - Shiny Black Rectangle Claw Clip
Macro view of a large rectangular hair claw clip with classic brown tortoiseshell pattern - Tortoiseshell Rectangle Claw Clip
Detail of a large heart-shaped brown acetate hair claw clip for elegant hairstyles - Transparent Amber Heart Claw Clip
Close-up of a glossy black heart-shaped acetate hair claw clip held by a hand - Shiny Black Heart Claw Clip
+4
Large Hair Claw Clips Plastic Resin Matte Glossy Rectangle Heart Shape Tortoise Shell Elegant Hair Styling Accessories For Women
$0.55-0.58
No MOQ
Creative Shell Cat Acetate Hair Claw Clip Sweet Shell Hair Clamp For Girls Elegant Back Head Hair Accessory Jewelry Gifts
Creative Shell Cat Acetate Hair Claw Clip Sweet Shell Hair Clamp For Girls Elegant Back Head Hair Accessory Jewelry Gifts
like
Find Similar
Detail of shell-shaped acetate hair claw with cat motif and gold engraved lines - White Shell Cat / White
Detail of pink marble acetate shell hair claw clip with cute cat and golden accents - Pink Shell Cat / Pink
Blue marble acetate shell hair claw with cute calico cat and golden line accents - Blue Shell Cat / Blue
Creative Shell Cat Acetate Hair Claw Clip Sweet Shell Hair Clamp For Girls Elegant Back Head Hair Accessory Jewelry Gifts
-5%
$3.34
No MOQ
Free Shipping
Ethnic Alloy Hair Rings Shell Leaf Star Hamsa Hand Cross Geometric Braid Jewelry Gold Silver Decorative Hair Clips Women
Ethnic Alloy Hair Rings Shell Leaf Star Hamsa Hand Cross Geometric Braid Jewelry Gold Silver Decorative Hair Clips Women
like
Find Similar
Detailed macro view of five shiny golden metal jump rings for jewelry making and hair braiding - Round / Gold Circle (6261)
Set of five silver geometric metal hair rings for DIY hair styling and braiding accessories - Round / Silver Circle (6262)
Set of five natural cream shell leaf charms with silver rings for DIY hair accessories - Shell / Silver Shell (6264)
Detailed view of five golden hollow leaf charms for hair braids on white background - Leaf / Gold Leaf (6265)
+7
NewEthnic Alloy Hair Rings Shell Leaf Star Hamsa Hand Cross Geometric Braid Jewelry Gold Silver Decorative Hair Clips Women
$0.29-0.40
No MOQ
Iridescent Starfish Hair Claw For Women Dreamy Artificial Pearl Finish Starfish Hair Clip For Summer Beach Vacation Hair Accessories
Iridescent Starfish Hair Claw For Women Dreamy Artificial Pearl Finish Starfish Hair Clip For Summer Beach Vacation Hair Accessories
like
Find Similar
Iridescent starfish hair claw clip with pearlescent finish on blue water background - Solid Yellow
Detail of iridescent starfish hair claw clip on sparkling blue water background - Solid Pink Yellow
Iridescent starfish hair claw clip with pearlescent pink and cyan gradient finish - Solid Green Pink
Iridescent starfish hair claw clip with holographic pearl finish for beach vacation - Solid Purple Yellow
+7
Iridescent Starfish Hair Claw For Women Dreamy Artificial Pearl Finish Starfish Hair Clip For Summer Beach Vacation Hair Accessories
$0.66
No MOQ
French Style Large Leopard Print Hair Claw Clip Durable Tortoise Shell Resin Shark Clip For Thick Hair Styling Accessories Women
French Style Large Leopard Print Hair Claw Clip Durable Tortoise Shell Resin Shark Clip For Thick Hair Styling Accessories Women
like
Find Similar
Macro shot of large gray leopard print resin hair claw clip with golden metal spring - 13cm Straight-Glossy Grey Leopard
Close-up of leopard print hair claw clip showing durable spring and acrylic texture - 13cm Straight-Glossy Beige Leopard
Detail shot of large leopard print hair claw clip on white textured background - 13cm Straight-Glossy Coffee Leopard
Detailed close-up of a leopard print claw clip with square hollow design on a white mat - 10.5cm Square-Glossy Grey Leopard
+7
French Style Large Leopard Print Hair Claw Clip Durable Tortoise Shell Resin Shark Clip For Thick Hair Styling Accessories Women
-4%
$0.41-0.44
No MOQ
Minimalist Alloy Metal Hair Claw Clip For Women Geometric Shell Faux Artificial Pearl Hollow Out Non-Slip Hair Accessory For Daily Party
Minimalist Alloy Metal Hair Claw Clip For Women Geometric Shell Faux Artificial Pearl Hollow Out Non-Slip Hair Accessory For Daily Party
like
Find Similar
Detail view of a golden shell hair claw clip with cutout lines and a white pearl accent - Bright Gold Shell Style
Elegant rose gold shell-shaped hair claw clip with pearls for women's hairstyle - Rose Gold Shell Style
Minimalist silver alloy shell hair claw clip with pearl accent on white background - Bright Silver Shell Style
Close-up of gunmetal grey alloy hair claw clip with polished metallic finish and strong spring - Black
+7
Minimalist Alloy Metal Hair Claw Clip For Women Geometric Shell Faux Artificial Pearl Hollow Out Non-Slip Hair Accessory For Daily Party
$0.52-0.66
No MOQ
Vacation Style Plastic Hair Claw Clip With Crack Texture Shell Flower Shape Elegant Hair Accessories For Women Hair Styling
Vacation Style Plastic Hair Claw Clip With Crack Texture Shell Flower Shape Elegant Hair Accessories For Women Hair Styling
like
Find Similar
Elegant white flower hair claw clip with cracked marble texture for women hairstyles - White Flower
Elegant cream flower hair claw clip with golden crackle texture and resin finish - Beige Flower
Pink crackle-textured flower hair claw clip with shell-like matte finish for women - Pink Flower
Light purple flower hair claw clip with a unique crackle texture for vacation styles - Purple Flower
+14
NewVacation Style Plastic Hair Claw Clip With Crack Texture Shell Flower Shape Elegant Hair Accessories For Women Hair Styling
$0.37-0.66
No MOQ
Handmade Oval Acetate Hair Clip Elegant Tortoise Shell Marble Pattern Duckbill Clip For Women French Style Hair Accessories
Handmade Oval Acetate Hair Clip Elegant Tortoise Shell Marble Pattern Duckbill Clip For Women French Style Hair Accessories
like
Find Similar
Elegant oval tortoise shell acetate hair clip with FRANCE Handmade lettering detail - Dark Tortoiseshell
Elegant oval tortoiseshell acetate hair clip with decorative Handmade engraving - Light Tortoiseshell
Minimalist black oval acetate hair clip with gold France Handmade lettering - Black
White oval acetate hair clip with FRANCE Handmade lettering in minimalist French style - White
+14
NewHandmade Oval Acetate Hair Clip Elegant Tortoise Shell Marble Pattern Duckbill Clip For Women French Style Hair Accessories
-5%
$0.55
No MOQ
Free Shipping
Plumeria Flower Hair Clips Artificial Foam Frangipani Duckbill Barrette Beach Seaside Vacation Summer Bridal Accessory
Plumeria Flower Hair Clips Artificial Foam Frangipani Duckbill Barrette Beach Seaside Vacation Summer Bridal Accessory
like
Find Similar
Frangipani flower hair clips in three sizes: large 9cm, medium 7cm, and small 5cm - 5CM Frangipani Style (Y1-095)
Plumeria Flower Hair Clips Artificial Foam Frangipani Duckbill Barrette Beach Seaside Vacation Summer Bridal Accessory
-5%
$0.19-0.23
No MOQ
 · 
34 sold recently
French Vintage Acetate Bowknot Barrette Elegant Marble Tortoise Shell Spring Clip For Women Fashion Hair Accessories
French Vintage Acetate Bowknot Barrette Elegant Marble Tortoise Shell Spring Clip For Women Fashion Hair Accessories
like
Find Similar
Chic acetate bow hair clip with colorful marble texture and golden lettering - 9.5CM / Iridescent Purple
Elegant off-white acetate bow hair clip with Barrette La France gold lettering - 9.5CM / Mermaid White
Elegant amber acetate bow hair clip with gold lettering on a stylish background - 9.5CM / Brown
Elegant tortoiseshell acetate bow hair clip with blue and amber marble patterns - 9.5CM / Chocolate Blue
+2
French Vintage Acetate Bowknot Barrette Elegant Marble Tortoise Shell Spring Clip For Women Fashion Hair Accessories
$2.02
No MOQ
Free Shipping
Iridescent Shell Hair Claw Clip With Artificial Pearls Elegant Seashell Hair Clip For Women Sweet Summer Beach Hair Accessories
Iridescent Shell Hair Claw Clip With Artificial Pearls Elegant Seashell Hair Clip For Women Sweet Summer Beach Hair Accessories
like
Find Similar
Elegant small iridescent pink shell hair claw clip with white pearls for women - Shell Pearl Style / Honey Yellow
Elegant shell-shaped hair claw clip in iridescent pearl pink with pearl embellishments - Shell Pearl Style / Ethereal Purple
Elegant iridescent blue shell hair claw clip with pearl accents for women's hairstyle - Shell Pearl Style / Ocean Blue
Pink shell hair claw clip with iridescent pearl finish and small pearl embellishments - Shell Pearl Style / Cream Pink
+2
Iridescent Shell Hair Claw Clip With Artificial Pearls Elegant Seashell Hair Clip For Women Sweet Summer Beach Hair Accessories
$1.07
Mix MOQ : 2
Free Shipping
Gradient Plumeria Flower Hair Claw Clip Hollow Out Shark Clip Summer Beach Vacation Hair Accessories For Women Girls
Gradient Plumeria Flower Hair Claw Clip Hollow Out Shark Clip Summer Beach Vacation Hair Accessories For Women Girls
like
Find Similar
Gradient orange-pink frangipani flower hair claw clip with matte translucent finish - 4cm / Orange-4cm
Frangipani hair claw clip with yellow gradient resin petals for summer hairstyling - 4cm / White-4cm
Pink gradient frangipani hair claw clip made of acrylic for summer hairstyles - 4cm / Pink-4cm
Elegant light blue gradient plumeria hair claw clip with semi-transparent finish - 4cm / Blue-4cm
+9
Gradient Plumeria Flower Hair Claw Clip Hollow Out Shark Clip Summer Beach Vacation Hair Accessories For Women Girls
$0.29-0.40
No MOQ
French Style Cellulose Acetate Hair Claw Clip For Women Large Marble Tortoise Shell Shark Clip Strong Hold Fashion Hair Accessories
French Style Cellulose Acetate Hair Claw Clip For Women Large Marble Tortoise Shell Shark Clip Strong Hold Fashion Hair Accessories
like
Find Similar
Elegant acetate shark hair claw clip in pastel macabre marble pattern for women - 8.5cm / Light Multi-color
Large marble cream acetate hair claw clip with elegant crossed teeth on wood background - 8.5cm / Off-white
Large acetate hair claw clip with red and white marble texture for french styling - 8.5cm / Bubble Red
Elegant amber brown tortoiseshell acetate hair claw clip with honeycomb texture for hair styling - 8.5cm / Bubble Brown
+9
French Style Cellulose Acetate Hair Claw Clip For Women Large Marble Tortoise Shell Shark Clip Strong Hold Fashion Hair Accessories
-5%
$2.24
No MOQ
Free Shipping
Stainless Steel Marine Shell Conch Starfish Hair Clip With Artificial Pearl Rhinestone Gold Fashion Hair Accessory For Women
Stainless Steel Marine Shell Conch Starfish Hair Clip With Artificial Pearl Rhinestone Gold Fashion Hair Accessory For Women
like
Find Similar
Macro detail of golden seashell hair clip with precise dimensions and weight specs - Realistic Conch Style (NMSH-E5510-1)
Detailed close-up of a gold-plated starfish hair clip with fine bionic texture and pearls - Starfish Shape (NMSH-E5510-2)
Detailed macro view of a golden shell hair clip with a pearl accent on a textured rock - Scallop Pearl Style (NMSH-E5510-3)
Macro detail of golden seashell hair clip with starfish and pearls on stone surface - Conch Starfish Combination (NMSH-F611-1)
+8
Stainless Steel Marine Shell Conch Starfish Hair Clip With Artificial Pearl Rhinestone Gold Fashion Hair Accessory For Women
$2.88-3.03
No MOQ
Free Shipping
French Elegant Large Matte Hair Claw Clip For Women Elegant Tortoise Shell Octopus Shark Clip Thick Hair Accessories
French Elegant Large Matte Hair Claw Clip For Women Elegant Tortoise Shell Octopus Shark Clip Thick Hair Accessories
like
Find Similar
Detailed view of matte black octopus hair claw clip on a minimalist ceramic plate - Matte Black
Detail of large tortoiseshell hair claw with octopus claw design on a white tray - Matte Amber
Detail shot of a matte white octopus hair claw clip on an elegant ceramic tray - Frosted White
Macro detail of large translucent orange octopus hair claw clip in a stylish design - Pumpkin-shaped / Pumpkin Clip Watermelon Red
+8
French Elegant Large Matte Hair Claw Clip For Women Elegant Tortoise Shell Octopus Shark Clip Thick Hair Accessories
-5%
$0.47-0.74
No MOQ
Large Conch Shell Hair Claw Acrylic Iridescent Pearlescent Hair Clip Beach Vacation Chic Accessory For Women
Large Conch Shell Hair Claw Acrylic Iridescent Pearlescent Hair Clip Beach Vacation Chic Accessory For Women
like
Find Similar
Close-up of a white acrylic seashell hair claw clip showing realistic texture and size - White Conch
Iridescent seashell hair claw clip with colorful acrylic finish for beach vacation styling - Colorful Conch
Large Conch Shell Hair Claw Acrylic Iridescent Pearlescent Hair Clip Beach Vacation Chic Accessory For Women
$1.59
No MOQ
Handmade French Acetate Hair Clip Marble Texture Colorful Tortoise Shell Spring Clip For Women Sweet Elegant Hair Accessories
Handmade French Acetate Hair Clip Marble Texture Colorful Tortoise Shell Spring Clip For Women Sweet Elegant Hair Accessories
like
Find Similar
Beige marble textured acetate hair barrette with France Handmade gold engraving - Cream White
Pink marbled acetate hair clip with gold label displayed in a ceramic bowl - Pink Buttercream
Elegant green rectangle hair clip with wood grain texture and silver metal spring barrette - Holographic Green
Detailed macro view of deep blue marble texture hair clip with silver France Handmade logo - Deep Sea Blue Green
+4
Handmade French Acetate Hair Clip Marble Texture Colorful Tortoise Shell Spring Clip For Women Sweet Elegant Hair Accessories
$1.50
No MOQ
Starfish Hair Claw Clips PVC Large Shark Clip Sweet Ocean Sea Star Smiley Face Pattern Beach Holiday Hair Accessories For Women
Starfish Hair Claw Clips PVC Large Shark Clip Sweet Ocean Sea Star Smiley Face Pattern Beach Holiday Hair Accessories For Women
like
Find Similar
Starfish hair claw clip with blue marine pattern on white background for women - Blue & White
Pink tie-dye starfish hair claw clip featuring colorful smiley face patterns and glossy finish - Pink White
Blue hair claw clip with white starfish pattern made of PVC for stylish ponytails - Blue
Translucent white starfish hair claw clip with colorful orange and blue patterns - Orange Blue
+1
Starfish Hair Claw Clips PVC Large Shark Clip Sweet Ocean Sea Star Smiley Face Pattern Beach Holiday Hair Accessories For Women
$1.24
Mix MOQ : 6
Orchid Flower Hair Comb Satin Fabric Artificial Floral Alloy Metal Headpiece Bridal Wedding Beach Vacation Boho Floral
Orchid Flower Hair Comb Satin Fabric Artificial Floral Alloy Metal Headpiece Bridal Wedding Beach Vacation Boho Floral
like
Find Similar
Bohemian hair comb with three red orchid flowers and gold metal teeth for bridal styling - Red
Detailed view of bohemian orange silk orchids mounted on a 20-tooth metal bridal hair comb - Orange
Close-up of three pink fabric orchid flowers on a gold 20-tooth metal hair comb - Pink
Detail of purple silk orchid flowers with black edges on a golden metal hair comb - Purple
+1
Orchid Flower Hair Comb Satin Fabric Artificial Floral Alloy Metal Headpiece Bridal Wedding Beach Vacation Boho Floral
-4%
$0.69
No MOQ
Ocean Starfish Shell Rhinestone Hair Claw Clip Acrylic Acetate Marble Hair Grips Vacation Summer Women Hair Accessories
Ocean Starfish Shell Rhinestone Hair Claw Clip Acrylic Acetate Marble Hair Grips Vacation Summer Women Hair Accessories
like
Find Similar
Macro shot of seashell and starfish decorations on a translucent cream white hair claw - 8.5cm / Mermaid White
Detailed macro shot of tortoiseshell shark hair claw with seashell and rhinestone accents - 8.5cm / Dark Brown
Detailed shot of dark blue marble hair claw with pink seashell and starfish accents - 8.5cm / Blue
Detail of ocean-themed hair claw clip with marble texture, seashell and starfish accents - 8.5cm / Green
+1
Ocean Starfish Shell Rhinestone Hair Claw Clip Acrylic Acetate Marble Hair Grips Vacation Summer Women Hair Accessories
$2.16
No MOQ
Creative Camping Theme Hair Claw Clip Cartoon Tent Camper Van Shape PVC Hair Clips For Women Outdoor Daily Hair Accessories
Creative Camping Theme Hair Claw Clip Cartoon Tent Camper Van Shape PVC Hair Clips For Women Outdoor Daily Hair Accessories
like
Find Similar
Cartoon red camping tent hair claw clip with blue details for creative hairstyles - Flame Red Tent Style (D11-2-5)
Cute yellow RV camper van shaped hair claw clip with measurements 8.1cm by 5cm size - Sunlight Camper Van Style (D11-2-6)
Camping tent hair claw clip in orange and brown tones with 8.1cm size measurements - Sunset Orange Tent Style (D11-2-7)
Creative camping van hair claw clip in white and orange finish for women's hairstyles - Orange Frost Camper Van Style (D11-2-8)
Creative Camping Theme Hair Claw Clip Cartoon Tent Camper Van Shape PVC Hair Clips For Women Outdoor Daily Hair Accessories
$1.04
Mix MOQ : 2
Handmade White Shell Flower Bridal Hair Comb With Artificial Pearls Rhinestone Elegant Wedding Hair Accessory For Women
Handmade White Shell Flower Bridal Hair Comb With Artificial Pearls Rhinestone Elegant Wedding Hair Accessory For Women
like
Find Similar
Elegant bridal hair comb with white shell petals, pearls and crystals on gold metal wire - Gold
Elegant bridal hair comb with white shell flowers, pearls, and crystals on a silver base - Silver
Handmade White Shell Flower Bridal Hair Comb With Artificial Pearls Rhinestone Elegant Wedding Hair Accessory For Women
-4%
$3.83
No MOQ
French Vintage Acetate Hair Claw Clips Marble Tortoise Shell Pattern Geometric Shark Clips For Women Styling Accessories
French Vintage Acetate Hair Claw Clips Marble Tortoise Shell Pattern Geometric Shark Clips For Women Styling Accessories
like
Find Similar
Classic amber tortoise shell acetate hair claw clip with cream base for ponytail styling - Beige Tortoise Shell
French vintage small tortoiseshell hair claw clip for elegant half-tied hairstyles - Coffee Tortoise Shell
French vintage tortoiseshell acetate hair claw clip with black and grey pattern - Polka Dot Coffee
Elegant square acetate hair claw clip featuring a classic black and white marble pattern - Cow Pattern
+9
French Vintage Acetate Hair Claw Clips Marble Tortoise Shell Pattern Geometric Shark Clips For Women Styling Accessories
-8%
$1.64
No MOQ
Free Shipping
Gradient Rainbow Plumeria Flower Hair Claw Large And Small Egg Flower Hair Clips For Beach Vacation Women Jewelry Accessories
Gradient Rainbow Plumeria Flower Hair Claw Large And Small Egg Flower Hair Clips For Beach Vacation Women Jewelry Accessories
like
Find Similar
Rainbow frangipani hair claw clip set with yellow and pink gradient flower hairpins - Rainbow Plumeria Style 1
Three-piece plumeria flower hair claw set in pink, orange, and green gradient colors - Rainbow Plumeria Style 2
Three-piece plumeria flower hair claw set with marble gradient resin finish in pastel colors - Rainbow Plumeria Style 3
Set of small and large gradient plumeria hair clips in blue, pink, and green tones - Rainbow Plumeria Style 4
+6
Gradient Rainbow Plumeria Flower Hair Claw Large And Small Egg Flower Hair Clips For Beach Vacation Women Jewelry Accessories
$0.81
Mix MOQ : 2
Elegant Acetate Shell Hair Claw Clip With Imitation Artificial Pearl Korean Style Iridescent Shark Clip For Women Hair Styling
Elegant Acetate Shell Hair Claw Clip With Imitation Artificial Pearl Korean Style Iridescent Shark Clip For Women Hair Styling
like
Find Similar
Pink iridescent shell hair claw clip with white pearl accents on minimalist tray - 9.3cm / Pink
Shell-shaped hair claw with pearlescent yellow acetate and white pearl accents - 9.3cm / Yellow
Iridescent blue shell-shaped hair claw clip with pearl accents on elegant display - 9.3cm / Blue
Elegant mint green shell hair claw clip with pearl embellishments and iridescent finish - 9.3cm / Cyan
+6
Elegant Acetate Shell Hair Claw Clip With Imitation Artificial Pearl Korean Style Iridescent Shark Clip For Women Hair Styling
$1.50-3.43
No MOQ
Free Shipping
French Acetate Mini Hair Claw Clips Vintage Tortoiseshell Shell Pattern Hair Clips For Women Girls Elegant Hair Accessories
French Acetate Mini Hair Claw Clips Vintage Tortoiseshell Shell Pattern Hair Clips For Women Girls Elegant Hair Accessories
like
Find Similar
Detailed close-up of a small dark brown acetate hair claw clip on soft gray fabric - Dark Coffee
Macro detail of amber acetate mini hair claw clip with Barrette La France gold engraving - Light Coffee
Detail of burgundy acetate hair claw with Barrette La France gold engraving on fabric - Dark Red
Detail of a beige acetate hair claw clip with golden lettering on cream fabric texture - Off White
+8
French Acetate Mini Hair Claw Clips Vintage Tortoiseshell Shell Pattern Hair Clips For Women Girls Elegant Hair Accessories
$0.86
No MOQ
Free Shipping
Alloy Metal Hair Scrunchies With Faux Artificial Pearl Star Shell Pendant Elastic Rubber Band Ponytail Holder Women Hair Decor
Alloy Metal Hair Scrunchies With Faux Artificial Pearl Star Shell Pendant Elastic Rubber Band Ponytail Holder Women Hair Decor
like
Find Similar
Detailed view of silver crescent metal and star pearl charm on a black elastic hair tie - Pentagram Pendant Style / Style H Gold
Minimalist gold alloy semi-circle hair tie with elegant white baroque pearl accent - Pearl Pendant Style / Double Row Gold
Detail of silver curved alloy hair ring with a white shell pendant and black elastic rope - Shell Pendant Style / Double Row Silver
Close-up of golden alloy semicircle hair tie with a white pearl-like star pendant - Pentagram Pendant Style / Single Row Gold
+8
Alloy Metal Hair Scrunchies With Faux Artificial Pearl Star Shell Pendant Elastic Rubber Band Ponytail Holder Women Hair Decor
-9%
$1.44
No MOQ
Free Shipping
Large Tortoise Shell Hair Claw Clips For Women Acetate Style Marble Pattern Hair Grabs Fashion Hair Styling Accessories
Large Tortoise Shell Hair Claw Clips For Women Acetate Style Marble Pattern Hair Grabs Fashion Hair Styling Accessories
like
Find Similar
Large black and white marble pattern acetic acid hair claw clip for elegant styling - Cow Print 10.5CM
Large cream marble acetate hair claw clip for elegant women styling and updo - Gem White 10.5CM
Large tortoiseshell acetate claw clip in rectangular hollow design for thick hair - Beige Tortoiseshell 10.5CM
Classic tortoiseshell hair claw clip for thick hair with rectangular hollow design - Coffee Tortoiseshell 10.5CM
+8
NewLarge Tortoise Shell Hair Claw Clips For Women Acetate Style Marble Pattern Hair Grabs Fashion Hair Styling Accessories
$1.21-1.56
No MOQ
Elegant Gold Plated Stainless Steel Hair Clip With Artificial Pearl Flower Starfish Shell Butterfly Designs For Women Fashion Accessory
Elegant Gold Plated Stainless Steel Hair Clip With Artificial Pearl Flower Starfish Shell Butterfly Designs For Women Fashion Accessory
like
Find Similar
Detail of 18K gold starfish and pearl hair clip showing dimensions 6cm and 1.2cm - Starfish Pearl Style (HC-H60026)
Detailed size specifications of 18K gold stainless steel double butterfly hair clip - Butterfly Metal Style (HC-H60027)
Detailed dimensions of a shell-shaped 18K gold-plated stainless steel hair clip - Double Shell Style (HC-H60028)
Detailed dimensions of the gold semi-circular stainless steel hair clip on white background - Half Round Ball Metal Style (HC-H60030)
+4
Elegant Gold Plated Stainless Steel Hair Clip With Artificial Pearl Flower Starfish Shell Butterfly Designs For Women Fashion Accessory
$2.88-4.90
No MOQ
Free Shipping
Acetate Hair Claw French Style Ponytail Clip Elegant Non-Slip Minimalist Shell Pattern Hair Accessories For Women
Acetate Hair Claw French Style Ponytail Clip Elegant Non-Slip Minimalist Shell Pattern Hair Accessories For Women
like
Find Similar
Detailed close-up of a pearlescent acetate hair claw clip with metallic spring on a book - Approx 6cm / White Mermaid
Elegant acetate hair claw clip with green and yellow marble patterns on white magazine background - Approx 6cm / Green Floral
Elegant amber marble acetate hair claw clip on a white magazine for women's styling - Approx 6cm / Yellow Textured
Detail of a beige glossy hair claw clip with golden Barrette La France text on a white book - Approx 6cm / Nude Pink
+4
Acetate Hair Claw French Style Ponytail Clip Elegant Non-Slip Minimalist Shell Pattern Hair Accessories For Women
$2.45
No MOQ
Free Shipping
Vintage Heart Hair Clip Acetate Spring Hairpin Color Blocking Floral Tortoise Shell Hair Accessories For Women Girls
Vintage Heart Hair Clip Acetate Spring Hairpin Color Blocking Floral Tortoise Shell Hair Accessories For Women Girls
like
Find Similar
Elegant floral acetate heart hair clip in beige and tortoiseshell finish for women - Beige & Brown Tortoiseshell
Detailed view of acetate heart hair clip in blue and tortoiseshell with gold lettering - Dark Blue & Tortoiseshell
Retro floral acetate heart hair clip in pink marble finish with five heart shapes - Pink & Pink Marble
Detail of floral and red acetate heart hair clips with golden label on wooden tray - Wine Red & Floral
+4
Vintage Heart Hair Clip Acetate Spring Hairpin Color Blocking Floral Tortoise Shell Hair Accessories For Women Girls
$1.69
Mix MOQ : 2
Free Shipping
Rectangular Seven Tooth Acetate Hair Claw For Women Leopard Tortoise Shell Pattern Minimalist Shark Clip Hair Accessory
Rectangular Seven Tooth Acetate Hair Claw For Women Leopard Tortoise Shell Pattern Minimalist Shark Clip Hair Accessory
like
Find Similar
Classic tortoise shell acetate hair claw clip with 7 teeth on dark wooden background - Light Tortoiseshell
Classic leopard print acetate hair claw clip with glossy tortoiseshell finish and 8 teeth - Dark Tortoiseshell
Glossy black acetate square hair claw clip with seven teeth on a wooden surface - Black
Macro shot of large tortoiseshell acetate claw clip showing amber resin texture on wood - Gold Lava
+4
Rectangular Seven Tooth Acetate Hair Claw For Women Leopard Tortoise Shell Pattern Minimalist Shark Clip Hair Accessory
$2.74-3.69
No MOQ
Free Shipping
Korean Style Acetate Shell Hair Clips Scallop Design Sweet Colorful Resin Duckbill Clips Fashion Hair Accessories For Women Girls
Korean Style Acetate Shell Hair Clips Scallop Design Sweet Colorful Resin Duckbill Clips Fashion Hair Accessories For Women Girls
like
Find Similar
Close-up of four gradient macaron shell hair clips on a white display card - Pink and Yellow Shell
Chic acetate shell hair clip with macaron gradient colors and pearlescent finish - Dreamy Purple and Green Shell
Detail view of purple acetate shell hair clip with glossy pearl texture on a display card - Taro Purple Shell
Handheld view of a lovely scallop shell acetate hair clip with pink and beige resin finish - Pink Shell
+3
Korean Style Acetate Shell Hair Clips Scallop Design Sweet Colorful Resin Duckbill Clips Fashion Hair Accessories For Women Girls
$1.30
No MOQ
Free Shipping
Handmade Cellulose Acetate Tortoise Shell Hair Comb Minimalist Korean Style Hair Fork For Women Daily Hair Accessories
Handmade Cellulose Acetate Tortoise Shell Hair Comb Minimalist Korean Style Hair Fork For Women Daily Hair Accessories
like
Find Similar
Elegant 14-tooth black curved hair comb detail with polished finish on canvas background - Black
Close-up of a brownish translucent resin hair side comb for neat hairstyle fixing - Transparent Grey
Minimalist tortoiseshell hair comb made of acetate for elegant side fringe styling - Transparent Coffee
Detail of tortoiseshell patterned hair comb with vintage design on a book cover - Dark Amber
+1
Handmade Cellulose Acetate Tortoise Shell Hair Comb Minimalist Korean Style Hair Fork For Women Daily Hair Accessories
$0.92
No MOQ
Free Shipping
Metal Dreadlock Accessories Hair Jewelry For Braids Hollow Out Rings Coils Shell Leaf Crown Charms For Women Girls
Metal Dreadlock Accessories Hair Jewelry For Braids Hollow Out Rings Coils Shell Leaf Crown Charms For Women Girls
like
Find Similar
290 pieces gold dreadlock hair jewelry set in transparent organizer box - 290Pcs (With Box) / Gold
290pcs silver metal dreadlock accessories kit with assorted hair rings and braid cuffs - 290Pcs (With Box) / Silver
Metal Dreadlock Accessories Hair Jewelry For Braids Hollow Out Rings Coils Shell Leaf Crown Charms For Women Girls
$3.75
Mix MOQ : 2
Alloy Metal Braid Hair Accessories Hollow Out Hair Rings With Shell Butterfly Charms For Dreadlocks Styling
Alloy Metal Braid Hair Accessories Hollow Out Hair Rings With Shell Butterfly Charms For Dreadlocks Styling
like
Find Similar
309pcs silver DIY dreadlock accessory set with metal rings, pendants, and 5m cord - 309 Pcs/Box / Silver
309pcs gold dreadlock accessories set including metal hair rings, sleeves and charms - 309 Pcs/Box / Gold
Alloy Metal Braid Hair Accessories Hollow Out Hair Rings With Shell Butterfly Charms For Dreadlocks Styling
$6.05
Mix MOQ : 2
Korean Style Acetate Hair Claw Clip Mini Tortoise Shell Leopard Print Hairpin For Women Ponytail Holder Hair Accessories
Korean Style Acetate Hair Claw Clip Mini Tortoise Shell Leopard Print Hairpin For Women Ponytail Holder Hair Accessories
like
Find Similar
Macro shot of small pearlescent white hair claw clip with iridescent finish and curved teeth - Aurora White
Detailed shot of a mini hair claw clip featuring a marble-patterned resin texture - Cream Tortoise
Close-up of tortoise shell pattern mini claw clip with smooth resin finish and spring - Brown Tortoiseshell
Detail view of small claw clip featuring elegant marble texture and tortoise shell pattern - Mint Green Brown Gradient
+4
Korean Style Acetate Hair Claw Clip Mini Tortoise Shell Leopard Print Hairpin For Women Ponytail Holder Hair Accessories
$1.07
No MOQ
Free Shipping
Elegant Acetate Cloud Hair Clip Duckbill Clip France Handmade Hair Tie Fashionable Tortoise Shell Cloud Hair Accessories For Women
Elegant Acetate Cloud Hair Clip Duckbill Clip France Handmade Hair Tie Fashionable Tortoise Shell Cloud Hair Accessories For Women
like
Find Similar
Iridescent cloud-shaped hair claw clip with gold accents in a white decorative dish - Pale Purple - Duckbill Clip / 4.4cm
Elegant red cloud acetate hair clip with gold France Handmade lettering on ceramic plate - Red - Duckbill Clip / 4.4cm
Elastic black hair tie with a red cloud-shaped acetate charm and gold lettering - Red - Hair Tie / 4.4cm
Pink and grey gradient acetate cloud hair clip with gold handmade lettering detail - Yellow Pink - Duckbill Clip / 4.4cm
+4
Elegant Acetate Cloud Hair Clip Duckbill Clip France Handmade Hair Tie Fashionable Tortoise Shell Cloud Hair Accessories For Women
$0.92
No MOQ
Large And Small Plumeria Flower Hair Claw Clips For Women Hawaiian Egg Flower Gradient Resin Hair Jaw Clips Summer Beach Hair Accessories
Large And Small Plumeria Flower Hair Claw Clips For Women Hawaiian Egg Flower Gradient Resin Hair Jaw Clips Summer Beach Hair Accessories
like
Find Similar
Close-up of white and yellow plumeria hair claw clips set on a jewelry display card - One Large And Two Small / White-Yellow Gradient
Close-up of three pink plumeria hair clips set on a white display card with metal springs - One Large And Two Small / White Pink Gradient
Three-piece purple gradient plumeria hair claw clip set on a white display card - One Large And Two Small / White And Purple Gradient
Detailed set of three yellow frangipani hair claws on a white display card packaging - One Large And Two Small / Lemon Yellow
+7
Large And Small Plumeria Flower Hair Claw Clips For Women Hawaiian Egg Flower Gradient Resin Hair Jaw Clips Summer Beach Hair Accessories
$0.61
No MOQ
Flower Hair Claw Clip Plumeria Acrylic Resin Glitter Gradient Shark Hairpin Hawaiian Beach Vacation Accessory For Women
Flower Hair Claw Clip Plumeria Acrylic Resin Glitter Gradient Shark Hairpin Hawaiian Beach Vacation Accessory For Women
like
Find Similar
8cm gradient brown frangipani hair claw clip with fine glitter in resin - 4cm / Black (Small Size)
8cm plumeria hair claw clip with orange gradient resin and golden glitter finish - 4cm / Orange Pink Gradient (Small)
Pink and green gradient Plumeria flower hair claw clip with gold glitter details - 4cm / Green (Small Size)
Blue-purple gradient flower hair claw clip with glitter finish for women - 4cm / Purple (Small)
+3
Flower Hair Claw Clip Plumeria Acrylic Resin Glitter Gradient Shark Hairpin Hawaiian Beach Vacation Accessory For Women
$0.43-0.58
Mix MOQ : 2
 · 
12 sold recently
Iridescent Plumeria Flower Hair Claw Clip For Women Laser Gradient Shark Clip Hawaiian Vacation Beach Hair Accessories Hairclip
Iridescent Plumeria Flower Hair Claw Clip For Women Laser Gradient Shark Clip Hawaiian Vacation Beach Hair Accessories Hairclip
like
Find Similar
Detailed view of amber yellow translucent plumeria hair claw clip with aurora coating - Bright Yellow
Close-up of translucent gradient plumeria hair claw clip on a decorative white plate - Pomegranate Red
Close-up of iridescent gradient pink flower hair claw clip on a pearl jewelry tray - Berry Red
Detail of colorful gradient plumeria hair claw clip with iridescent finish on white ceramic plate - Cyan Blue
+2
Iridescent Plumeria Flower Hair Claw Clip For Women Laser Gradient Shark Clip Hawaiian Vacation Beach Hair Accessories Hairclip
$0.77
Mix MOQ : 5
Acetate Marble Pattern Hair Claw Clip For Women High Grade Large Shark Clip Tortoise Shell Hair Accessories For Daily Styling
Acetate Marble Pattern Hair Claw Clip For Women High Grade Large Shark Clip Tortoise Shell Hair Accessories For Daily Styling
like
Find Similar
Detailed view of an amber-colored acetate hair claw clip on a clean white background - Tortoise Shell
Close-up of small acetate hair claw clip with amber marble texture and glossy resin finish - Brown Coffee
Detail view of small blue leopard print acetate hair claw clip with smooth glossy finish - Blue Leopard
Detail of translucent marble pattern hair claw clip in elegant smoky gray finish - Smoky Gray
+2
Acetate Marble Pattern Hair Claw Clip For Women High Grade Large Shark Clip Tortoise Shell Hair Accessories For Daily Styling
$2.45
No MOQ
Free Shipping
Handmade Bridal Hair Vine With Artificial Pearl Rhinestone Shell Flower Wedding Hairband For Women Photography Party Jewelry
Handmade Bridal Hair Vine With Artificial Pearl Rhinestone Shell Flower Wedding Hairband For Women Photography Party Jewelry
like
Find Similar
Detail view of 100cm bridal hair vine with copper wire, imitation pearls, and small white flowers - 100CM Pearl Floral Style (HS-J7372G-100CM)
Handmade 100cm bridal hair vine with white resin flowers and pearls on golden wire - 100CM Resin Flower Pearl Style (HS-J4878-100CM)
Detailed macro view of a 100cm bridal vine with pearls, crystals, and silver wire - 100CM Crystal Pearl Vine Style (HS-J4411-100CM)
Handmade bridal hair vine with white flowers, pearls, and organza ribbons for weddings - 35CM Organza Tie Pearl Style (HS-J6989G-35CM)
+2
Handmade Bridal Hair Vine With Artificial Pearl Rhinestone Shell Flower Wedding Hairband For Women Photography Party Jewelry
-5%
$1.20-6.02
No MOQ
Free Shipping
Go to

More in accessories

Explore more in summer theme hair accessories

clawgirlshairpinhandmadepartyponytailgeometricwidehearthollow
resinartificialplasticmetaldailywovenbandresin hairgold platedpolyester

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access