Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Men Vintage Horse Head Shield Signet Ring Stainless Steel Hip Hop Knight Punk Band Ring Gold Silver Two Tone Jewelry Gift
Men Vintage Horse Head Shield Signet Ring Stainless Steel Hip Hop Knight Punk Band Ring Gold Silver Two Tone Jewelry Gift
like
Find Similar
Men's retro shield ring with golden horse emblem and silver finish on a mirror surface - US 7 / Gold
+5
Men Vintage Horse Head Shield Signet Ring Stainless Steel Hip Hop Knight Punk Band Ring Gold Silver Two Tone Jewelry Gift
$3.93
No MOQ
Free Shipping
Vintage Stainless Steel Pentagram Ring Men Gothic Punk Hexagon Shield Signet Ring Geometric Band Jewelry Gift Steel Color
Vintage Stainless Steel Pentagram Ring Men Gothic Punk Hexagon Shield Signet Ring Geometric Band Jewelry Gift Steel Color
like
Find Similar
Vintage stainless steel pentagram ring with black textured hexagonal shield for men - US 7 / Steel
+6
Vintage Stainless Steel Pentagram Ring Men Gothic Punk Hexagon Shield Signet Ring Geometric Band Jewelry Gift Steel Color
-4%
$3.24
No MOQ
Free Shipping
Vintage Gothic Stainless Steel Skeleton Hand Ace of Spades Poker Ring For Men Retro Punk Biker Gambling Finger Ring Jewelry
Vintage Gothic Stainless Steel Skeleton Hand Ace of Spades Poker Ring For Men Retro Punk Biker Gambling Finger Ring Jewelry
like
Find Similar
7 options
Vintage Gothic Stainless Steel Skeleton Hand Ace of Spades Poker Ring For Men Retro Punk Biker Gambling Finger Ring Jewelry
$3.09
No MOQ
 · 
22 sold recently
Free Shipping
Vintage Punk Pentagram Star Ring Alloy Rhinestone Distressed Retro Antique Silver Hip Hop Rock Men Adjustable Band Jewelry
Vintage Punk Pentagram Star Ring Alloy Rhinestone Distressed Retro Antique Silver Hip Hop Rock Men Adjustable Band Jewelry
like
Find Similar
Detail of vintage silver pentagram ring with a faceted red gemstone in punk style - Pentagram Style (00946) / Antique Silver + Red
Macro view of vintage hip-hop star ring featuring a green gemstone and antique finish - Pentagram Style (00946) / Antique Silver + Deep Green
Vintage Punk Pentagram Star Ring Alloy Rhinestone Distressed Retro Antique Silver Hip Hop Rock Men Adjustable Band Jewelry
$1.02
No MOQ
Free Shipping
Vintage Titanium Steel Rotatable Ring Buddhist Mantra Relief Spinner Religious Jewelry Band Ring For Men Women
Vintage Titanium Steel Rotatable Ring Buddhist Mantra Relief Spinner Religious Jewelry Band Ring For Men Women
like
Find Similar
Vintage titanium steel rotating ring featuring embossed Buddhist symbols and blackened finish - US 7 / Silver
+6
Vintage Titanium Steel Rotatable Ring Buddhist Mantra Relief Spinner Religious Jewelry Band Ring For Men Women
$3.40
No MOQ
Free Shipping
Vintage Sunbeam Titanium Steel Ring For Men Retro Gold Silver Two Tone Red Rhinestone Inlaid Punk Band Jewelry Gift
Vintage Sunbeam Titanium Steel Ring For Men Retro Gold Silver Two Tone Red Rhinestone Inlaid Punk Band Jewelry Gift
like
Find Similar
Retro stainless steel ring with sunray stripes and a golden diamond center stone - US 7 / Antique Silver Gold
+5
Vintage Sunbeam Titanium Steel Ring For Men Retro Gold Silver Two Tone Red Rhinestone Inlaid Punk Band Jewelry Gift
-5%
$3.73
No MOQ
Free Shipping
Vintage Ring Set For Women Alloy Synthetic Gemstone Snake Butterfly Heart Shapes Retro Bohemian Finger Jewelry Accessories
Vintage Ring Set For Women Alloy Synthetic Gemstone Snake Butterfly Heart Shapes Retro Bohemian Finger Jewelry Accessories
like
Find Similar
7pcs vintage gold ring set with snake motif and pink rhinestones on a hand model - Snake Pink Gemstone 7-Piece Set / Pink Gemstone Gold Set (22493-rose red)
Bohemian gold ring set featuring snake and flower designs with emerald-like stones - Snake Flower Feather 6-Piece Set / Green Gemstone Gold Set (22481-gold)
8-piece gold snake and butterfly ring set with green gemstones on model hand - Snake Butterfly Star 8-Piece Set / Green Gemstone Butterfly Gold Set (22490-gold)
Close-up of bohemian gold rings set with blue sapphires and snake motifs on hand - Butterfly Snake Star 9-Piece Set / Blue Gemstone Gold Set (22490-blue)
+4
Vintage Ring Set For Women Alloy Synthetic Gemstone Snake Butterfly Heart Shapes Retro Bohemian Finger Jewelry Accessories
$0.65-0.97
Mix MOQ : 2
Stainless Steel Flower Ring 18K Gold Plated Artificial Pearl Natural Stone Inlaid Statement Ring For Women Jewelry
Stainless Steel Flower Ring 18K Gold Plated Artificial Pearl Natural Stone Inlaid Statement Ring For Women Jewelry
like
Find Similar
Vintage flower ring in 18k gold plated stainless steel with hammered texture detail - 18K Gold Plated / Hammered Texture Floral Style (JZ21066)
Gold stainless steel flower ring with pearls, waterproof and hypoallergenic finish - 18K Gold Plated / Artificial Pearl Flower Cluster Style (JZ21254)
18K gold plated stainless steel flower ring with natural stone and waterproof finish - 18K Gold Plated / Wavy Textured Flower Style (JZ21343)
Vintage 18K gold plated stainless steel floral ring with a brown tiger eye stone - 18K Gold Plated / Tiger Eye Stone Center Floral Style (JZ21456)
+8
Stainless Steel Flower Ring 18K Gold Plated Artificial Pearl Natural Stone Inlaid Statement Ring For Women Jewelry
$1.96-2.83
No MOQ
Free Shipping
304 Stainless Steel Adjustable Daisy Flower Ring Base DIY Jewelry Findings For Women Fashion Open Rings Jewelry Making
304 Stainless Steel Adjustable Daisy Flower Ring Base DIY Jewelry Findings For Women Fashion Open Rings Jewelry Making
like
Find Similar
Detailed size chart showing dimensions and weight of daisy flower shaped stainless steel ring - Steel
Golden sunflower ring dimensions showing weight 5.9g and diameter 2.6cm on white background - Gold
304 Stainless Steel Adjustable Daisy Flower Ring Base DIY Jewelry Findings For Women Fashion Open Rings Jewelry Making
$0.39-0.52
Mix MOQ : 2
Minimalist Band Ring Titanium Steel Faceted Lattice Wave Design Stylish Polished Metal Jewelry Accessory For Women Daily Wear
Minimalist Band Ring Titanium Steel Faceted Lattice Wave Design Stylish Polished Metal Jewelry Accessory For Women Daily Wear
like
Find Similar
21 options
Minimalist Band Ring Titanium Steel Faceted Lattice Wave Design Stylish Polished Metal Jewelry Accessory For Women Daily Wear
$1.18-1.31
No MOQ
 · 
260 sold recently
Free Shipping
Retro Stainless Steel Elephant Head Ring For Men Punk Vintage Animal Relief Design Statement Gothic Jewelry Finger Ring
Retro Stainless Steel Elephant Head Ring For Men Punk Vintage Animal Relief Design Statement Gothic Jewelry Finger Ring
like
Find Similar
7 options
Retro Stainless Steel Elephant Head Ring For Men Punk Vintage Animal Relief Design Statement Gothic Jewelry Finger Ring
$3.46
No MOQ
Free Shipping
Vintage Titanium Steel FTW Letter Ring For Men Punk Biker Style Honeycomb Pattern Black Silver Gold Fashion Jewelry Gift
Vintage Titanium Steel FTW Letter Ring For Men Punk Biker Style Honeycomb Pattern Black Silver Gold Fashion Jewelry Gift
like
Find Similar
6 options
Vintage Titanium Steel FTW Letter Ring For Men Punk Biker Style Honeycomb Pattern Black Silver Gold Fashion Jewelry Gift
$3.67
No MOQ
Free Shipping
Fashion Men Titanium Steel Ring With Meteorite Texture Inlay Polished Industrial Style Band Ring For Women Men Unisex Jewelry Finger Accessories Gift
Fashion Men Titanium Steel Ring With Meteorite Texture Inlay Polished Industrial Style Band Ring For Women Men Unisex Jewelry Finger Accessories Gift
like
Find Similar
Titanium steel ring for men with gold polished edges and silver ice foil inlay - US 7 / Gold
Men's titanium steel ring with silver meteorite pattern inlay and polished finish - US 7 / Silver
Men's titanium ring featuring black band with silver meteorite inlay and polished edges - US 7 / Black
Blue titanium steel ring for men featuring silver grey meteorite textured inlay - US 7 / Blue
+28
Fashion Men Titanium Steel Ring With Meteorite Texture Inlay Polished Industrial Style Band Ring For Women Men Unisex Jewelry Finger Accessories Gift
-3%
$0.50
Mix MOQ : 2
 · 
83 sold recently
Vintage 304 Stainless Steel Natural Stone Open Ring Gold Plated Tiger Eye Lapis Lazuli Adjustable Geometric Beaded Ring For Women Jewelry
Vintage 304 Stainless Steel Natural Stone Open Ring Gold Plated Tiger Eye Lapis Lazuli Adjustable Geometric Beaded Ring For Women Jewelry
like
Find Similar
304 stainless steel adjustable ring with vintage amber stone and beaded gold band - Tiger Eye Texture Style (J820-G-T)
Macro view of gold beaded stainless steel ring with a round blue lapis stone inlay - Lapis Lazuli Texture Style (J820-G-D)
Detail of gold vintage adjustable ring with white bead on beige silk fabric - White Mother of Pearl Texture Style (J820-G-W)
Vintage 304 Stainless Steel Natural Stone Open Ring Gold Plated Tiger Eye Lapis Lazuli Adjustable Geometric Beaded Ring For Women Jewelry
$1.31
Mix MOQ : 2
Free Shipping
Punk Rock Men's Stainless Steel Skull Ring Gothic Skeleton Head Finger Ring For Men Women Black Gold Silver Fashion Jewelry
Punk Rock Men's Stainless Steel Skull Ring Gothic Skeleton Head Finger Ring For Men Women Black Gold Silver Fashion Jewelry
like
Find Similar
Detailed macro view of silver stainless steel skull ring with gothic punk head engraving - US 7 / Steel
Polished gold skull ring for men in stainless steel with a high-shine mirror finish - US 7 / Gold
Gothic skull ring for men in matte black stainless steel with realistic carved details - US 7 / Black
+24
Punk Rock Men's Stainless Steel Skull Ring Gothic Skeleton Head Finger Ring For Men Women Black Gold Silver Fashion Jewelry
-4%
$2.91-3.16
No MOQ
Free Shipping
Titanium Steel 18K Gold Plated Rhombus Hollow Open Ring Minimalist Geometric Adjustable Finger Ring For Women Daily Fashion Jewelry
Titanium Steel 18K Gold Plated Rhombus Hollow Open Ring Minimalist Geometric Adjustable Finger Ring For Women Daily Fashion Jewelry
like
Find Similar
Minimalist silver open ring with geometric hollow rhombus pattern and beaded edge detail - US 7 / Steel
French minimalist hollow gold ring with diamond pattern in tarnish-free titanium steel - US 7 / Gold
NewTitanium Steel 18K Gold Plated Rhombus Hollow Open Ring Minimalist Geometric Adjustable Finger Ring For Women Daily Fashion Jewelry
$2.93
No MOQ
Free Shipping
Irregular Oversized Two-Tone Stainless Steel Open Ring 18k Gold Plated Gold Silver Mixed Color Minimalist Jewelry For Women
Irregular Oversized Two-Tone Stainless Steel Open Ring 18k Gold Plated Gold Silver Mixed Color Minimalist Jewelry For Women
like
Find Similar
Two-tone stainless steel teardrop ring with irregular organic shape and mirror finish - Gold Silver Mixed Color Style (JDR0111017-PS)
Irregular Oversized Two-Tone Stainless Steel Open Ring 18k Gold Plated Gold Silver Mixed Color Minimalist Jewelry For Women
$4.85
No MOQ
Free Shipping
Vintage Punk Open Rings Copper Metal Adjustable Gothic Mythical Shield Crown Jewelry For Men Unisex Retro Industrial
Vintage Punk Open Rings Copper Metal Adjustable Gothic Mythical Shield Crown Jewelry For Men Unisex Retro Industrial
like
Find Similar
Macro shot of silver vintage star cross ring showing retro textured finish on white background - Adjustable Open / Eight-Pointed Star
Vintage Thai silver style wide ring with kitsune relief and Celtic knot patterns - Adjustable Open / Ninetales Fox
Vintage silver stackable ring for men with golden crown relief and sparkling crystal inlay - Adjustable Open / Crown
Vintage Thai silver style cross ring with engraved hollow pattern and open adjustable band - Adjustable Open / Cross
+10
Vintage Punk Open Rings Copper Metal Adjustable Gothic Mythical Shield Crown Jewelry For Men Unisex Retro Industrial
$0.86-1.57
No MOQ
 · 
12 views
Free Shipping
Angel Number Rings Stainless Steel Gold Plated Minimalist Lucky Jewelry For Women Men Ins Style
Angel Number Rings Stainless Steel Gold Plated Minimalist Lucky Jewelry For Women Men Ins Style
like
Find Similar
Macro shot of minimalist gold stainless steel ring featuring 111 angel number engraving - US 10 / 111
Detailed view of a gold-plated stainless steel ring featuring engraved number 222 detail - US 10 / 222
Macro shot of gold stainless steel ring featuring 444 engraving with a mirror reflection - US 10 / 444
Macro view of gold stainless steel ring featuring 555 engraved angel numbers detail - US 10 / 555
+36
Angel Number Rings Stainless Steel Gold Plated Minimalist Lucky Jewelry For Women Men Ins Style
$0.68
No MOQ
 · 
212 sold recently
Free Shipping
Vintage Alloy Tai Chi Yin Yang Bagua Open Ring Retro Adjustable Hip Hop Streetwear Finger Ring For Men Women Jewelry
Vintage Alloy Tai Chi Yin Yang Bagua Open Ring Retro Adjustable Hip Hop Streetwear Finger Ring For Men Women Jewelry
like
Find Similar
Retro Tai Chi Yin Yang Bagua ring made of vintage finish alloy with 24mm face height - Silver
Vintage Alloy Tai Chi Yin Yang Bagua Open Ring Retro Adjustable Hip Hop Streetwear Finger Ring For Men Women Jewelry
$0.73
Mix MOQ : 2
Free Shipping
Retro Stainless Steel Rotatable Ring For Men Women Buddhist Om Mani Padme Hum Mantra Embossed Stress Relief Jewelry Band Ring
Retro Stainless Steel Rotatable Ring For Men Women Buddhist Om Mani Padme Hum Mantra Embossed Stress Relief Jewelry Band Ring
like
Find Similar
Vintage stainless steel spinner ring with engraved Om Mani Padme Hum mantra symbols - US 7 / Steel
+6
Retro Stainless Steel Rotatable Ring For Men Women Buddhist Om Mani Padme Hum Mantra Embossed Stress Relief Jewelry Band Ring
$3.40
No MOQ
Free Shipping
Minimalist Titanium Steel Sunburst Signet Ring For Women 18K Gold Silver Plated Stripe Geometric Chic Fashion Jewelry Gift
Minimalist Titanium Steel Sunburst Signet Ring For Women 18K Gold Silver Plated Stripe Geometric Chic Fashion Jewelry Gift
like
Find Similar
Minimalist silver sunburst ring with radial texture and elegant sun pattern finish - US 5 / Silver
Minimalist 18K gold sunburst signet ring in stainless steel with vintage sun pattern - US 5 / Gold
+12
Minimalist Titanium Steel Sunburst Signet Ring For Women 18K Gold Silver Plated Stripe Geometric Chic Fashion Jewelry Gift
-4%
$2.74-2.99
No MOQ
Free Shipping
Retro Titanium Steel Sunflower Ring For Women Men Vintage Oxidized Daisy Floral Band Finger Jewelry Gift
Retro Titanium Steel Sunflower Ring For Women Men Vintage Oxidized Daisy Floral Band Finger Jewelry Gift
like
Find Similar
6 options
Retro Titanium Steel Sunflower Ring For Women Men Vintage Oxidized Daisy Floral Band Finger Jewelry Gift
-5%
$3.48
No MOQ
Free Shipping
925 Sterling Silver Chain Link Ring For Women Light Luxury Inlaid Zirconia Oval Interlocking Finger Ring Valentine Jewelry Gift
925 Sterling Silver Chain Link Ring For Women Light Luxury Inlaid Zirconia Oval Interlocking Finger Ring Valentine Jewelry Gift
like
Find Similar
Elegant silver chain ring with pavé-set sparkling zircons for women's gift wear - US 5 / Silver
Luxurious gold chain ring with sparkling pavé zircon oval centerpiece for women - US 5 / Gold
+6
925 Sterling Silver Chain Link Ring For Women Light Luxury Inlaid Zirconia Oval Interlocking Finger Ring Valentine Jewelry Gift
$20.96
No MOQ
 · 
11 sold recently
Free Shipping
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
like
Find Similar
Polished S925 sterling silver ring with 18k gold plating in a classic band style - Gold 6mm / US Size 8
Classic 925 sterling silver ring with polished gold finish, slim band design - US Size 5 / Gold 2mm
Classic high-polished S925 sterling silver band ring with a clean flat edge design - US Size 5 / Silver 2mm
Close-up of classic polished S925 silver band ring with inner 925 engraving - US Size 8 / Silver 6mm
+131
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
$14.28-25.81
No MOQ
Free Shipping
Luxury Stainless Steel Adjustable Open Ring For Women Enamel Water Ripple Hollow Design Wave Band Fashion Artistic Jewelry
Luxury Stainless Steel Adjustable Open Ring For Women Enamel Water Ripple Hollow Design Wave Band Fashion Artistic Jewelry
like
Find Similar
Macro shot of gold-plated open ring with colorful enamel inlay and wave texture - Rainbow
Detailed close-up of golden adjustable butterfly ring with pink and white enamel inlay - Pink
Adjustable gold plated stainless steel wave ring with colorful enamel inlay detail - Teal
Luxury Stainless Steel Adjustable Open Ring For Women Enamel Water Ripple Hollow Design Wave Band Fashion Artistic Jewelry
-4%
$1.62
No MOQ
Free Shipping
Vintage Alloy Hollow Cloud Pattern Rings For Women Men Couple Monkey King Golden Hoop Open Finger Rings Fashion Jewelry Gift
Vintage Alloy Hollow Cloud Pattern Rings For Women Men Couple Monkey King Golden Hoop Open Finger Rings Fashion Jewelry Gift
like
Find Similar
Detail view of two-tone hollow cloud pattern ring with silver and rose gold finish - 16 / Silver
Vintage Alloy Hollow Cloud Pattern Rings For Women Men Couple Monkey King Golden Hoop Open Finger Rings Fashion Jewelry Gift
$1.05
Mix MOQ : 2
Free Shipping
Retro Gothic Snake Ring For Men Women Titanium Steel 3D Animal Scales Distressed Punk Style Statement Ring Jewelry Gift
Retro Gothic Snake Ring For Men Women Titanium Steel 3D Animal Scales Distressed Punk Style Statement Ring Jewelry Gift
like
Find Similar
Retro punk snake ring in vintage silver finish with 3D scales on a black mirror surface - US 7 / Steel
Vintage gold snake ring in 3D scale texture with an adjustable open design for men and women - US 7 / Gold
+10
Retro Gothic Snake Ring For Men Women Titanium Steel 3D Animal Scales Distressed Punk Style Statement Ring Jewelry Gift
-4%
$2.99-3.24
No MOQ
Free Shipping
Simple Stainless Steel Band Ring Polished Beveled Edge Minimalist Jewelry For Men Women Couples Anniversary Gift
Simple Stainless Steel Band Ring Polished Beveled Edge Minimalist Jewelry For Men Women Couples Anniversary Gift
like
Find Similar
Polished gold stainless steel minimalist ring with sleek mirrored beveled edges - 4mm / US 5 / Gold (KR105991-WGFL)
Minimalist silver stainless steel ring with polished beveled edges for couples - 4mm / US 5 / Steel Color (KR105990-WGFL)
Minimalist 4mm rose gold stainless steel ring with polished finish for couples - 4mm / US 5 / Rose Gold (KR102948-WGBL)
Minimalist black polished stainless steel ring with double beveled edges for couples - 4mm / US 5 / Black (KR105992-WGFL)
+45
Simple Stainless Steel Band Ring Polished Beveled Edge Minimalist Jewelry For Men Women Couples Anniversary Gift
$0.48-0.60
No MOQ
 · 
30 sold recently
Free Shipping
925 Sterling Silver Geometric Twist Ring For Women Micro Pave Zirconia Mobius Band Ring Minimalist Daily Finger Jewelry
925 Sterling Silver Geometric Twist Ring For Women Micro Pave Zirconia Mobius Band Ring Minimalist Daily Finger Jewelry
like
Find Similar
5 options
925 Sterling Silver Geometric Twist Ring For Women Micro Pave Zirconia Mobius Band Ring Minimalist Daily Finger Jewelry
-14%
$13.39
No MOQ
Free Shipping
Punk Vintage Octopus Skull Ring For Men Titanium Steel Cthulhu Tentacles Ring Gothic Biker Finger Ring Individual Jewelry Gift
Punk Vintage Octopus Skull Ring For Men Titanium Steel Cthulhu Tentacles Ring Gothic Biker Finger Ring Individual Jewelry Gift
like
Find Similar
Vintage punk silver octopus skull ring in stainless steel with Cthulhu style details - US 7 / Steel
Detailed close-up of a punk style golden octopus skull ring with high metallic luster - US 7 / Gold
Macro detail of gothic octopus ring with skull head and textured tentacles on black background - US 7 / Black
+18
Punk Vintage Octopus Skull Ring For Men Titanium Steel Cthulhu Tentacles Ring Gothic Biker Finger Ring Individual Jewelry Gift
$3.62-3.88
Mix MOQ : 3
 · 
12 views
Free Shipping
Retro Lion Head Relief Ring For Men Stainless Steel Polished Aggressive Band Ring Vintage Hip Hop Animal Jewelry Gift
Retro Lion Head Relief Ring For Men Stainless Steel Polished Aggressive Band Ring Vintage Hip Hop Animal Jewelry Gift
like
Find Similar
Vintage lion head signet ring for men in gold-plated stainless steel with relief design - US 7 / Gold
Men's vintage silver stainless steel lion head signet ring worn on a person's hand - US 7 / Steel
+12
NewRetro Lion Head Relief Ring For Men Stainless Steel Polished Aggressive Band Ring Vintage Hip Hop Animal Jewelry Gift
-4%
$2.74-2.99
No MOQ
Free Shipping
Vintage Religious Jesus Christ Relief Stainless Steel Ring For Men Personalized Two Tone Gold Silver Cross Punk Seal Signet Ring
Vintage Religious Jesus Christ Relief Stainless Steel Ring For Men Personalized Two Tone Gold Silver Cross Punk Seal Signet Ring
like
Find Similar
Vintage retro men's silver and gold titanium steel ring with Jesus and cross detail - US 8 / Steel
+4
Vintage Religious Jesus Christ Relief Stainless Steel Ring For Men Personalized Two Tone Gold Silver Cross Punk Seal Signet Ring
$3.98
No MOQ
Free Shipping
Elegant Copper Rhinestone Adjustable Open Ring For Women Classic One Carat Look Camellia Flower Crown Design Fashion Finger Jewelry For Wedding Party
Elegant Copper Rhinestone Adjustable Open Ring For Women Classic One Carat Look Camellia Flower Crown Design Fashion Finger Jewelry For Wedding Party
like
Find Similar
Classic S925 silver moissanite ring with 1 carat stone and adjustable band - Adjustable Open Ring / Men's Square Four-Prong Pave Style (NAN001) / Silver
Luxury classic one carat moissanite ring with adjustable open silver-colored band for women - Adjustable Open Ring / Men's Square Step Cut Pave Style (NAN003) / Silver
Elegant S925 silver Moissanite ring featuring a 1 carat stone and an adjustable band. - Adjustable Open Ring / Wave Side Four-Prong Style (NAN011) / Silver
Classic 1 carat solitaire moissanite ring with polished S925 silver finish band - Adjustable Open Ring / Men's Minimalist Square Four-Prong Style (NAN012) / Silver
+40
Elegant Copper Rhinestone Adjustable Open Ring For Women Classic One Carat Look Camellia Flower Crown Design Fashion Finger Jewelry For Wedding Party
$0.47-2.49
No MOQ
 · 
62 sold recently
Free Shipping
Vintage Stainless Steel Octopus Tentacle Ring Gothic Punk Suction Cup Finger Rings For Men Biker Party Jewelry
Vintage Stainless Steel Octopus Tentacle Ring Gothic Punk Suction Cup Finger Rings For Men Biker Party Jewelry
like
Find Similar
7 options
Vintage Stainless Steel Octopus Tentacle Ring Gothic Punk Suction Cup Finger Rings For Men Biker Party Jewelry
$3.35
No MOQ
Free Shipping
Retro Knights Templar Shield Signet Ring Men's Vintage Titanium Steel Warrior Relief Medieval Punk Finger Jewelry Ring
Retro Knights Templar Shield Signet Ring Men's Vintage Titanium Steel Warrior Relief Medieval Punk Finger Jewelry Ring
like
Find Similar
Vintage stainless steel signet ring for men featuring a medieval knight shield relief - US 7 / Vintage Steel Silver
+6
Retro Knights Templar Shield Signet Ring Men's Vintage Titanium Steel Warrior Relief Medieval Punk Finger Jewelry Ring
$3.14
No MOQ
Free Shipping
Vintage Alloy Owl Adjustable Open Ring For Men Hip Hop Rap Style Retro Silver Color Animal Statement Ring Jewelry Gift
Vintage Alloy Owl Adjustable Open Ring For Men Hip Hop Rap Style Retro Silver Color Animal Statement Ring Jewelry Gift
like
Find Similar
Vintage adjustable owl ring in silver alloy with detailed feather textures and 13mm width - Silver
Vintage Alloy Owl Adjustable Open Ring For Men Hip Hop Rap Style Retro Silver Color Animal Statement Ring Jewelry Gift
$0.73
Mix MOQ : 2
Vintage Punk Feather Alloy Open Ring For Men Retro Gothic Hip Hop Adjustable Finger Ring Statement Jewelry Gift
Vintage Punk Feather Alloy Open Ring For Men Retro Gothic Hip Hop Adjustable Finger Ring Statement Jewelry Gift
like
Find Similar
Retro punk style four-feather adjustable open ring with vintage silver finish - Adjustable Feather Style / Silver
Vintage Punk Feather Alloy Open Ring For Men Retro Gothic Hip Hop Adjustable Finger Ring Statement Jewelry Gift
$0.73
Mix MOQ : 2
925 Sterling Silver Wavy Curved Stackable Rings For Women Minimalist Knuckle Band Thin Line Finger Ring Jewelry Gift
925 Sterling Silver Wavy Curved Stackable Rings For Women Minimalist Knuckle Band Thin Line Finger Ring Jewelry Gift
like
Find Similar
Set of seven minimalist S925 sterling silver wavy rings with a high-polished metallic finish - US 7
+6
925 Sterling Silver Wavy Curved Stackable Rings For Women Minimalist Knuckle Band Thin Line Finger Ring Jewelry Gift
-12%
$5.48
No MOQ
Free Shipping
Retro Stainless Steel All-Seeing Eye Triangle Ring Gothic Cross Punk Religious Biker Band Ring For Men Women Jewelry
Retro Stainless Steel All-Seeing Eye Triangle Ring Gothic Cross Punk Religious Biker Band Ring For Men Women Jewelry
like
Find Similar
Men's titanium steel Eye of Horus ring with silver finish and side cross engraving - US 7 / Antique Silver
+5
Retro Stainless Steel All-Seeing Eye Triangle Ring Gothic Cross Punk Religious Biker Band Ring For Men Women Jewelry
-4%
$3.12
No MOQ
Free Shipping
Minimalist Stainless Steel Snake Open Ring For Women Gold Silver Plated Adjustable Animal Finger Ring Fashion Jewelry Gift
Minimalist Stainless Steel Snake Open Ring For Women Gold Silver Plated Adjustable Animal Finger Ring Fashion Jewelry Gift
like
Find Similar
1 option
Minimalist Stainless Steel Snake Open Ring For Women Gold Silver Plated Adjustable Animal Finger Ring Fashion Jewelry Gift
$2.78
Mix MOQ : 2
Free Shipping
925 Sterling Silver Colorful Round Zirconia Ring For Women Minimalist Stackable Candy Color Fashion Commute Finger Jewelry
925 Sterling Silver Colorful Round Zirconia Ring For Women Minimalist Stackable Candy Color Fashion Commute Finger Jewelry
like
Find Similar
Minimalist S925 sterling silver ring with royal blue round gemstone and bead texture - US 5 / Blue
Elegant S925 sterling silver ring featuring a round green gemstone and beaded band detail - US 5 / Green
S925 sterling silver ring with pink zircon gemstone and beaded texture in a 45-degree view - US 5 / Pink
S925 sterling silver ring with a round pigeon blood red zircon and beaded edge detail - US 5 / Red
+26
925 Sterling Silver Colorful Round Zirconia Ring For Women Minimalist Stackable Candy Color Fashion Commute Finger Jewelry
-14%
$11.59
No MOQ
Free Shipping
Minimalist Stainless Steel Rings For Women Geometric Oval Wave Pattern Irregular Artificial Pearl Open Band Ring Fashion Jewelry Gift
Minimalist Stainless Steel Rings For Women Geometric Oval Wave Pattern Irregular Artificial Pearl Open Band Ring Fashion Jewelry Gift
like
Find Similar
Detail view of Baroque pearl ring with 1.27cm diameter and 1.73cm inner band measurements - Irregular Artificial Pearl Style (JDRW2409021-S-7)
Detailed spec view of a silver oval bean stainless steel ring showing exact dimensions - Double Bean Pod Design Style (JDR0303003-S)
Minimalist Stainless Steel Rings For Women Geometric Oval Wave Pattern Irregular Artificial Pearl Open Band Ring Fashion Jewelry Gift
$2.49-4.45
No MOQ
Free Shipping
Women Fashion Adjustable Open Rings Copper Gold Plated Zircon Inlaid Geometric Evil Eye Butterfly Rainbow Vintage Jewelry
Women Fashion Adjustable Open Rings Copper Gold Plated Zircon Inlaid Geometric Evil Eye Butterfly Rainbow Vintage Jewelry
like
Find Similar
Detail of 18K gold adjustable ring featuring a green marquise stone and zircon accents - Gold-Green Marquise Rectangle
Detail of adjustable gold ring featuring seven round rainbow cubic zirconia stones - Gold-Rainbow Stones
Detailed macro shot of vintage 18K gold-plated adjustable ring with square black stone - Gold-Black Square Stone
Adjustable 18K gold-plated ring with a green teardrop stone and zircon chain design - Gold-Green Drop Chain
+7
Women Fashion Adjustable Open Rings Copper Gold Plated Zircon Inlaid Geometric Evil Eye Butterfly Rainbow Vintage Jewelry
$1.28-3.38
No MOQ
 · 
1 reviews
Free Shipping
Men Retro Punk Star Alloy Rhinestone Ring Vintage Hip Hop Style Antique Silver Geometric Inlaid Finger Ring Fashion Jewelry
Men Retro Punk Star Alloy Rhinestone Ring Vintage Hip Hop Style Antique Silver Geometric Inlaid Finger Ring Fashion Jewelry
like
Find Similar
Detailed view of vintage star ring with black multifaceted gemstone on a stone surface - Five-pointed Star Black Gemstone Style (00946) / Antique Silver + Black
Close-up of gothic star ring with a red gemstone on dark textured background - Five-pointed Star Red Gemstone Style (00946) / Antique Silver + Red
Close-up of vintage star ring with green gemstone inlay and distressed silver finish - Five-pointed Star Deep Green Gemstone Style (00946) / Antique Silver + Deep Green
Men Retro Punk Star Alloy Rhinestone Ring Vintage Hip Hop Style Antique Silver Geometric Inlaid Finger Ring Fashion Jewelry
$1.02
No MOQ
Free Shipping
Iridescent Titanium Steel Ring For Men Rainbow Minimalist Plain Band Fashion Jewelry Accessory Gift For Student Boyfriend
Iridescent Titanium Steel Ring For Men Rainbow Minimalist Plain Band Fashion Jewelry Accessory Gift For Student Boyfriend
like
Find Similar
Macro shot of titanium steel ring with blue-purple gradient finish and gold inner band - US 6 / Colorful
+7
Iridescent Titanium Steel Ring For Men Rainbow Minimalist Plain Band Fashion Jewelry Accessory Gift For Student Boyfriend
-6%
$0.31
No MOQ
Minimalist Titanium Steel Triple Interlocked Rings Multilayer Zirconia Inlaid Fashion Jewelry For Men And Women Couple Accessory
Minimalist Titanium Steel Triple Interlocked Rings Multilayer Zirconia Inlaid Fashion Jewelry For Men And Women Couple Accessory
like
Find Similar
Three-layer titanium steel ring with silver finish and pavé zircon stones on black background - Number 5 / Steel
Three-layer gold titanium steel ring with micro-pave crystals on black background - Number 5 / Gold
Three-layer rose gold titanium steel ring with sparkling pave cubic zirconia accents - Number 5 / Rose Gold
+12
Minimalist Titanium Steel Triple Interlocked Rings Multilayer Zirconia Inlaid Fashion Jewelry For Men And Women Couple Accessory
$3.14-3.41
No MOQ
Free Shipping
Minimalist Ultra Thin Titanium Steel Band Ring Polished Stacking Pinky Ring For Women Elegant Simple Daily Hand Jewelry
Minimalist Ultra Thin Titanium Steel Band Ring Polished Stacking Pinky Ring For Women Elegant Simple Daily Hand Jewelry
like
Find Similar
Minimalist 1mm rose gold plated stainless steel stackable ring for women - 3# / Rose Gold
Minimalist 1mm silver polished stainless steel ring for women in a sleek round design - 3# / Steel
Polished 1mm rose gold titanium steel ring with ultra-thin minimalist band design - 3# / Gold
+24
Minimalist Ultra Thin Titanium Steel Band Ring Polished Stacking Pinky Ring For Women Elegant Simple Daily Hand Jewelry
-5%
$0.37-0.63
No MOQ
 · 
50 sold recently
Free Shipping
Irregular Lava Texture Twisted Open Ring For Women Minimalist Liquid Metal Style Silver Plated Copper Adjustable Ring
Irregular Lava Texture Twisted Open Ring For Women Minimalist Liquid Metal Style Silver Plated Copper Adjustable Ring
like
Find Similar
Detail of the irregular lava texture and polished silver finish on the open ring - Adjustable Open / Silver
Irregular Lava Texture Twisted Open Ring For Women Minimalist Liquid Metal Style Silver Plated Copper Adjustable Ring
-11%
$2.77
No MOQ
 · 
12 sold recently
Free Shipping
Vintage Stainless Steel Men Ring Distressed Hip Hop Geometric Signet Finger Ring Punk Style Retro Jewelry Accessory
Vintage Stainless Steel Men Ring Distressed Hip Hop Geometric Signet Finger Ring Punk Style Retro Jewelry Accessory
like
Find Similar
Retro stainless steel punk ring for men featuring vintage relief texture and flat surface - US 7 / Vintage Silver
+11
Vintage Stainless Steel Men Ring Distressed Hip Hop Geometric Signet Finger Ring Punk Style Retro Jewelry Accessory
$3.35
No MOQ
Free Shipping
Vintage Stainless Steel Celtic Knot Ring For Men Women Punk Rock Wide Band Ring Antique Steel Color Gothic Jewelry Accessory
Vintage Stainless Steel Celtic Knot Ring For Men Women Punk Rock Wide Band Ring Antique Steel Color Gothic Jewelry Accessory
like
Find Similar
7 options
Vintage Stainless Steel Celtic Knot Ring For Men Women Punk Rock Wide Band Ring Antique Steel Color Gothic Jewelry Accessory
$3.46
No MOQ
Free Shipping
Hip Hop Stainless Steel Libra Ring For Men Gold Plated Pave Rhinestone Green Black Cat Eye Stone Retro Signet Ring Jewelry
Hip Hop Stainless Steel Libra Ring For Men Gold Plated Pave Rhinestone Green Black Cat Eye Stone Retro Signet Ring Jewelry
like
Find Similar
Men's gold plated stainless steel Libra ring with green opal and white zircons - US 7 / Gold Green Stone
Gold-plated hip hop signet ring with black cat-eye stone and rhinestones for men - US 7 / Gold Black Stone
+12
Hip Hop Stainless Steel Libra Ring For Men Gold Plated Pave Rhinestone Green Black Cat Eye Stone Retro Signet Ring Jewelry
$3.67
No MOQ
Free Shipping
Vintage Octopus Tentacle Stainless Steel Ring For Men Women Punk Rock Gothic Open Adjustable Band Ring Ocean Animal Jewelry Gift
Vintage Octopus Tentacle Stainless Steel Ring For Men Women Punk Rock Gothic Open Adjustable Band Ring Ocean Animal Jewelry Gift
like
Find Similar
Vintage octopus tentacle stainless steel open ring with detailed suction cups - US 7 / Steel
Vintage octopus tentacle ring in gold finish with textured suction cup relief design - US 7 / Gold
Vintage bronze octopus tentacle ring made of stainless steel with adjustable open band - US 7 / Gold and Black
+18
Vintage Octopus Tentacle Stainless Steel Ring For Men Women Punk Rock Gothic Open Adjustable Band Ring Ocean Animal Jewelry Gift
$3.14-3.41
No MOQ
Free Shipping
Cartoon Animal Open Rings Alloy Drip Oil Enamel Cute Cat Rabbit Eye Adjustable Finger Jewelry For Women Girls Novelty Fun
Cartoon Animal Open Rings Alloy Drip Oil Enamel Cute Cat Rabbit Eye Adjustable Finger Jewelry For Women Girls Novelty Fun
like
Find Similar
Close-up of a creative black bunny ring with pink enamel detail on a model's hand - Black and Pink Cat Style (3#)
Detailed view of a cute black cat ring with yellow eyes worn on a finger - Black Cat Style (4#)
Cute pink frog-shaped jewelry box with velvet flocking texture for stylish rings - Pink Frog Flocked Jewelry Box (14#)
Cartoon Animal Open Rings Alloy Drip Oil Enamel Cute Cat Rabbit Eye Adjustable Finger Jewelry For Women Girls Novelty Fun
$0.65-1.02
No MOQ
 · 
25 views
Free Shipping
Gothic Bat Ring Stainless Steel Black Matte Hollow Wings Finger Ring Halloween Party Punk Retro Unisex Fashion Jewelry
Gothic Bat Ring Stainless Steel Black Matte Hollow Wings Finger Ring Halloween Party Punk Retro Unisex Fashion Jewelry
like
Find Similar
Vintage gothic black bat ring in matte stainless steel for men with detailed wing texture - US 7 / Black
+6
Gothic Bat Ring Stainless Steel Black Matte Hollow Wings Finger Ring Halloween Party Punk Retro Unisex Fashion Jewelry
$3.67
No MOQ
Free Shipping
Vintage Lion Head Ring For Men Stainless Steel Punk Rock Gothic Animal Biker Band Ring Hip Hop Jewelry Accessory Gift
Vintage Lion Head Ring For Men Stainless Steel Punk Rock Gothic Animal Biker Band Ring Hip Hop Jewelry Accessory Gift
like
Find Similar
Men's vintage lion head stainless steel ring with detailed 3D carving in punk style - US 7 / Steel
Men's bold lion head ring in gold finish stainless steel with black oxidized details - US 7 / Gold
+12
Vintage Lion Head Ring For Men Stainless Steel Punk Rock Gothic Animal Biker Band Ring Hip Hop Jewelry Accessory Gift
-4%
$2.74-2.99
No MOQ
 · 
11 sold recently
Free Shipping
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
like
Find Similar
6-piece men's black titanium steel ring set with square signet and matte finishes - US 6 / Retro Punk Style (SMTZ215)
6-piece set of men's black titanium steel rings featuring vintage punk and matte designs - US 6 / Modern Industrial Style (SMTZ216)
+14
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
$4.58-5.50
No MOQ
Free Shipping
Stainless Steel Spinner Ring For Men Women Religious Six Word Mantra Sanskrit Symbols Stress Relief Band Ring Jewelry
Stainless Steel Spinner Ring For Men Women Religious Six Word Mantra Sanskrit Symbols Stress Relief Band Ring Jewelry
like
Find Similar
Minimalist titanium steel ring with silver brushed finish and engraved sacred symbols - US 7 / Narrow Ring
Spinner ring made of brushed stainless steel with engraved black religious symbols - US 7 / Wide Ring
+10
Stainless Steel Spinner Ring For Men Women Religious Six Word Mantra Sanskrit Symbols Stress Relief Band Ring Jewelry
-5%
$1.87-1.99
No MOQ
Free Shipping
Vintage Titanium Steel Men's Ring Square Red Black Purple Rhinestone Inlaid Gothic Punk Style Biker Finger Ring Jewelry
Vintage Titanium Steel Men's Ring Square Red Black Purple Rhinestone Inlaid Gothic Punk Style Biker Finger Ring Jewelry
like
Find Similar
Vintage men's titanium steel ring with black square gemstone and gothic scroll engraving - US 7 / Steel Black
Vintage men's titanium steel ring with square purple gemstone and ornate carvings - US 7 / Purple
Men's vintage titanium steel ring with square red gemstone and scroll engravings - US 7 / Red
+15
Vintage Titanium Steel Men's Ring Square Red Black Purple Rhinestone Inlaid Gothic Punk Style Biker Finger Ring Jewelry
$4.98
No MOQ
Free Shipping
S925 Sterling Silver Minimalist Ring For Women Matte Frosted Texture Retro Style Artistic Geometric Stacking Finger Ring
S925 Sterling Silver Minimalist Ring For Women Matte Frosted Texture Retro Style Artistic Geometric Stacking Finger Ring
like
Find Similar
Minimalist S925 sterling silver stackable ring set with polished and matte textured finishes - US 10 / Ancient Matte Silver
+4
S925 Sterling Silver Minimalist Ring For Women Matte Frosted Texture Retro Style Artistic Geometric Stacking Finger Ring
-12%
$11.20-11.70
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access