Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

Popular collections in toe rings

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Toe Rings Adjustable Brass Metal Gold Silver Plated Zircon Rhinestone Open Minimalist Summer Beach Jewelry For Women
Toe Rings Adjustable Brass Metal Gold Silver Plated Zircon Rhinestone Open Minimalist Summer Beach Jewelry For Women
like
Find Similar
Adjustable silver open toe ring with spiral pattern and auspicious cloud design - Style 1 / Silver
Detail of silver adjustable toe ring with spiral swirl and star element design - Style 2-Star / Silver
Adjustable silver spiral open toe ring with polished finish for women summer beach - Style 4-Double Spiral / Silver
Adjustable silver swirl toe ring for women with artistic abstract design and polished finish - Style 7-Abstract Vortex / Silver
+12
Toe Rings Adjustable Brass Metal Gold Silver Plated Zircon Rhinestone Open Minimalist Summer Beach Jewelry For Women
$0.71
Mix MOQ : 2
 · 
343 sold recently
Top 10% Best Sellers
in Body Jewelry
Free Shipping
Geometric Copper Toe Rings For Women Adjustable Open Band Hollow Beach Jewelry Bohemian Sexy Ethnic Style Metal Foot Decor
Geometric Copper Toe Rings For Women Adjustable Open Band Hollow Beach Jewelry Bohemian Sexy Ethnic Style Metal Foot Decor
like
Find Similar
Minimalist double spiral toe ring in golden finish with geometric metallic open design - Gold Double Spiral Style (A-769)
Silver infinity design hollow ring, adjustable toe ring for women in beach jewelry style - Silver Infinity Cross Style
Silver geometric metal open ring with spiral and curve design for beach fashion - Bright Silver Spiral Curve (A-1092)
Minimalist golden spiral swirl open toe ring with smooth metallic finish on white background - KC Gold Spiral Swirl (A-1093)
Geometric Copper Toe Rings For Women Adjustable Open Band Hollow Beach Jewelry Bohemian Sexy Ethnic Style Metal Foot Decor
-6%
$0.47-0.59
No MOQ
 · 
61 sold recently
Free Shipping
S925 Sterling Silver Open Toe Rings For Women Adjustable Daisy Flower Double Layer Rhinestone Summer Beach Foot Jewelry
S925 Sterling Silver Open Toe Rings For Women Adjustable Daisy Flower Double Layer Rhinestone Summer Beach Foot Jewelry
like
Find Similar
S925 sterling silver open toe ring with sparkling multi-row cubic zirconia inlay - Style 1 (Pave Zircon Silver) / Silver
Close-up of golden daisy flower open toe ring featuring delicate polished floral patterns - Style 2 (Daisy Gold) / Gold
Close-up of golden S925 sterling silver toe ring featuring sparkling cubic zirconia inlay - Style 1 (Pave Zircon Gold) / Gold
Minimalist S925 sterling silver open daisy flower toe ring with adjustable band on white background - Style 2 (Daisy Silver) / Silver
+2
S925 Sterling Silver Open Toe Rings For Women Adjustable Daisy Flower Double Layer Rhinestone Summer Beach Foot Jewelry
-18%
$7.72-8.21
No MOQ
 · 
96 sold recently
Free Shipping
Starfish Toe Ring Stainless Steel Sea Star Ocean Theme Adjustable Open Ring Summer Beach Foot Jewelry For Women
Starfish Toe Ring Stainless Steel Sea Star Ocean Theme Adjustable Open Ring Summer Beach Foot Jewelry For Women
like
Find Similar
Gold starfish toe ring in stainless steel with textured sea design on beach sand - Gold (F1171)
Silver ocean star open ring for women on beach sand, adjustable marine jewelry - Silver (F1172)
Starfish Toe Ring Stainless Steel Sea Star Ocean Theme Adjustable Open Ring Summer Beach Foot Jewelry For Women
$0.37-0.50
No MOQ
 · 
15 sold recently
Free Shipping
Infinity Shape Toe Ring For Women Minimalist Alloy Smooth Surface Adjustable Finger Ring Vintage Style Jewelry
Infinity Shape Toe Ring For Women Minimalist Alloy Smooth Surface Adjustable Finger Ring Vintage Style Jewelry
like
Find Similar
1 option
Infinity Shape Toe Ring For Women Minimalist Alloy Smooth Surface Adjustable Finger Ring Vintage Style Jewelry
$0.42
No MOQ
 · 
112 sold recently
Free Shipping
925 Sterling Silver V-Shaped Open Toe Ring For Women Rhinestone Pavé Adjustable Foot Jewelry Minimalist Silver Color Ring
925 Sterling Silver V-Shaped Open Toe Ring For Women Rhinestone Pavé Adjustable Foot Jewelry Minimalist Silver Color Ring
like
Find Similar
Adjustable S925 sterling silver V-shaped toe ring featuring minimalist white zircon inlay - 925 Silver / White Gold
925 Sterling Silver V-Shaped Open Toe Ring For Women Rhinestone Pavé Adjustable Foot Jewelry Minimalist Silver Color Ring
$8.46
No MOQ
 · 
1 reviews
Free Shipping
S925 Sterling Silver White Opal Toe Ring For Women Minimalist Zirconia Adjustable Open Finger Ring Bohemian Jewelry Gift
S925 Sterling Silver White Opal Toe Ring For Women Minimalist Zirconia Adjustable Open Finger Ring Bohemian Jewelry Gift
like
Find Similar
Adjustable S925 sterling silver toe ring with three round white opals and small diamonds - 925 Silver / White
S925 Sterling Silver White Opal Toe Ring For Women Minimalist Zirconia Adjustable Open Finger Ring Bohemian Jewelry Gift
$13.10
No MOQ
 · 
1 reviews
Free Shipping
925 Sterling Silver Three Layer Open Toe Ring Fashion Minimalist Adjustable Polished Finger Ring For Women Summer Beach Jewelry
925 Sterling Silver Three Layer Open Toe Ring Fashion Minimalist Adjustable Polished Finger Ring For Women Summer Beach Jewelry
like
Find Similar
Minimalist S925 sterling silver triple-layer open toe ring with a polished metallic finish - Adjustable Open / White Gold
Elegant 925 sterling silver triple wave open ring with gold plating for women - Adjustable Open / Gold
925 Sterling Silver Three Layer Open Toe Ring Fashion Minimalist Adjustable Polished Finger Ring For Women Summer Beach Jewelry
-5%
$11.20
No MOQ
 · 
10 sold recently
Free Shipping
Hip Hop Open Ring Titanium Steel Double Bead Ball End Adjustable Minimalist Knuckle Finger Toe Jewelry For Women Men
Hip Hop Open Ring Titanium Steel Double Bead Ball End Adjustable Minimalist Knuckle Finger Toe Jewelry For Women Men
like
Find Similar
Hip hop style black horseshoe titanium steel ring with double ball ends on white background - Adjustable Open / Black
Minimalist rose gold titanium steel open ring with polished spherical ends in a C-shape design - Adjustable Open / Rose Gold
Classic silver horseshoe C-shaped open hoop ring with polished titanium steel finish - Adjustable Open / Silver
Polished gold hip-hop style open ring featuring a double bead minimalist metal design - Adjustable Open / Gold
Hip Hop Open Ring Titanium Steel Double Bead Ball End Adjustable Minimalist Knuckle Finger Toe Jewelry For Women Men
$0.65
No MOQ
 · 
21 views
Free Shipping
Vintage Alloy Toe Ring Leaf Engraved Antique Silver Adjustable Open Foot Jewelry For Women Beach Retro Bohemian
Vintage Alloy Toe Ring Leaf Engraved Antique Silver Adjustable Open Foot Jewelry For Women Beach Retro Bohemian
like
Find Similar
1 option
Vintage Alloy Toe Ring Leaf Engraved Antique Silver Adjustable Open Foot Jewelry For Women Beach Retro Bohemian
$0.31
No MOQ
 · 
35 sold recently
Free Shipping
S925 Sterling Silver Open Toe Ring For Women Gold Plated Adjustable Wave Hammered Texture Summer Beach Fashion Foot Jewelry
S925 Sterling Silver Open Toe Ring For Women Gold Plated Adjustable Wave Hammered Texture Summer Beach Fashion Foot Jewelry
like
Find Similar
Minimalist adjustable wave-patterned open toe ring in 925 sterling silver gold plating - 925 Silver / Gold
S925 Sterling Silver Open Toe Ring For Women Gold Plated Adjustable Wave Hammered Texture Summer Beach Fashion Foot Jewelry
$6.60
No MOQ
 · 
48 views
Free Shipping
S925 Sterling Silver Opal Open Toe Ring For Women Minimalist Adjustable Foot Jewelry Sexy Summer Beach Accessory
S925 Sterling Silver Opal Open Toe Ring For Women Minimalist Adjustable Foot Jewelry Sexy Summer Beach Accessory
like
Find Similar
1 option
S925 Sterling Silver Opal Open Toe Ring For Women Minimalist Adjustable Foot Jewelry Sexy Summer Beach Accessory
-17%
$8.21
No MOQ
 · 
25 sold recently
Free Shipping
925 Sterling Silver Toe Ring Minimalist Adjustable Open Band Summer Beach Foot Jewelry For Women Polished Simple Accessory
925 Sterling Silver Toe Ring Minimalist Adjustable Open Band Summer Beach Foot Jewelry For Women Polished Simple Accessory
like
Find Similar
Minimalist S925 sterling silver open toe ring in gold finish with a polished mirror surface - Gold
Minimalist S925 sterling silver open toe ring with polished finish and adjustable design - White Gold
925 Sterling Silver Toe Ring Minimalist Adjustable Open Band Summer Beach Foot Jewelry For Women Polished Simple Accessory
-21%
$6.81
No MOQ
 · 
45 sold recently
Free Shipping
Vintage Baroque Gold Plated Titanium Steel Tiger Eye Faux Ruby Onyx Rhinestone Inlaid Band Ring For Men Women Jewelry
Vintage Baroque Gold Plated Titanium Steel Tiger Eye Faux Ruby Onyx Rhinestone Inlaid Band Ring For Men Women Jewelry
like
Find Similar
Vintage gold men's tiger eye ring with black rhinestones and intricate side carvings - US 8 / Tiger's Eye
Vintage gold titanium steel ring with large red stone and black crystal accents - US 8 / Red Faux Gemstone
Vintage gold steel ring with black gemstone center and intricate floral carvings - US 8 / Black Faux Gemstone
+12
Vintage Baroque Gold Plated Titanium Steel Tiger Eye Faux Ruby Onyx Rhinestone Inlaid Band Ring For Men Women Jewelry
$3.67-3.93
No MOQ
 · 
34 sold recently
Free Shipping
Vintage Stainless Steel Rings For Men Women Tree Of Life Greek Key Celtic Knot Hip Hop Punk Finger Rings Jewelry Gift
Vintage Stainless Steel Rings For Men Women Tree Of Life Greek Key Celtic Knot Hip Hop Punk Finger Rings Jewelry Gift
like
Find Similar
Five-piece vintage stainless steel ring set for men with Celtic and Tree of Life patterns - US 7 / Vintage Silver (SMTZ204)
+6
Vintage Stainless Steel Rings For Men Women Tree Of Life Greek Key Celtic Knot Hip Hop Punk Finger Rings Jewelry Gift
$5.84
No MOQ
 · 
32 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
925 Sterling Silver Cross Toe Ring For Women Rhinestone Inlaid Adjustable Open Foot Ring Beach Summer Fashion Jewelry
925 Sterling Silver Cross Toe Ring For Women Rhinestone Inlaid Adjustable Open Foot Ring Beach Summer Fashion Jewelry
like
Find Similar
Minimalist 925 sterling silver open toe ring with sparkling cross shaped zirconia accents - 925 Silver / White Gold (F024)
925 Sterling Silver Cross Toe Ring For Women Rhinestone Inlaid Adjustable Open Foot Ring Beach Summer Fashion Jewelry
$8.10
No MOQ
 · 
1 reviews
Free Shipping
S925 Sterling Silver Toe Rings For Women Minimalist Adjustable Open Toe Rings Beach Summer Jewelry Daisy Knot Rhinestone Foot Jewelry
S925 Sterling Silver Toe Rings For Women Minimalist Adjustable Open Toe Rings Beach Summer Jewelry Daisy Knot Rhinestone Foot Jewelry
like
Find Similar
Elegant gold-plated S925 sterling silver toe ring with sparkling pavé cubic zirconia - Rhinestone Style - Gold
Minimalist S925 sterling silver daisy toe ring in golden finish for women - Daisy Design - Gold
Adjustable S925 sterling silver toe ring featuring delicate daisy flower design - Daisy Design - Silver
Elegant adjustable S925 sterling silver toe ring with sparkling white cubic zirconia row - Rhinestone Style - Silver
+4
S925 Sterling Silver Toe Rings For Women Minimalist Adjustable Open Toe Rings Beach Summer Jewelry Daisy Knot Rhinestone Foot Jewelry
-9%
$8.12-9.96
No MOQ
 · 
12 sold recently
Free Shipping
925 Sterling Silver Zirconia Toe Ring Minimalist Open Foot Ring For Women Fashion Body Jewelry Skinny Eternity Band Jewelry
925 Sterling Silver Zirconia Toe Ring Minimalist Open Foot Ring For Women Fashion Body Jewelry Skinny Eternity Band Jewelry
like
Find Similar
Elegant S925 sterling silver open toe ring with sparkling pavé cubic zirconia diamonds - 925 Silver / White Gold
925 Sterling Silver Zirconia Toe Ring Minimalist Open Foot Ring For Women Fashion Body Jewelry Skinny Eternity Band Jewelry
-5%
$8.46
No MOQ
 · 
56 views
Free Shipping
Vintage Men Titanium Steel Signet Ring Retro Punk Style With Green Black Stone And Tiger Eye Square Inlay Fashion Jewelry
Vintage Men Titanium Steel Signet Ring Retro Punk Style With Green Black Stone And Tiger Eye Square Inlay Fashion Jewelry
like
Find Similar
Retro steel ring with rectangular turquoise gemstone and geometric hollow patterns - US 7 / Steel Green Stone
Vintage men's silver steel signet ring with square black stone inlay and side reliefs - US 7 / Steel Black Stone
Men's vintage silver steel ring featuring a square tiger eye stone and Greek fret patterns - US 7 / Tiger's Eye
+18
Vintage Men Titanium Steel Signet Ring Retro Punk Style With Green Black Stone And Tiger Eye Square Inlay Fashion Jewelry
-5%
$3.93
No MOQ
 · 
49 sold recently
Free Shipping
Men Minimalist Titanium Steel Brushed Ring Double Groove Design Fashion Jewelry Band Ring Silver Black Gold Blue Colors
Men Minimalist Titanium Steel Brushed Ring Double Groove Design Fashion Jewelry Band Ring Silver Black Gold Blue Colors
like
Find Similar
Macro view of matte brushed titanium steel ring with double gold grooved parallel lines - US 6 / Two Gold Lines
Detail view of silver brushed titanium steel ring with parallel black stripes for men - US 6 / Two Black Lines
Close-up of brushed titanium steel ring with parallel blue grooves and polished inner band - US 6 / Two Blue Lines
+21
Men Minimalist Titanium Steel Brushed Ring Double Groove Design Fashion Jewelry Band Ring Silver Black Gold Blue Colors
-4%
$0.45
No MOQ
 · 
130 sold recently
925 Sterling Silver Gold Plated Constellation Open Toe Ring Adjustable Summer Beach Jewelry Rhinestone Inlaid Foot Ring
925 Sterling Silver Gold Plated Constellation Open Toe Ring Adjustable Summer Beach Jewelry Rhinestone Inlaid Foot Ring
like
Find Similar
S925 sterling silver gold plated zodiac ring with letter R and blue gemstone on white background - Gold Aries
Macro shot of Taurus zodiac ring in gold plating with sparkling cubic zirconia inlay - Gold Taurus
Close-up of golden Gemini zodiac toe ring with a sparkling green zircon stone detail - Gold Gemini
Macro detail of gold S925 silver toe ring with purple gemstone and zodiac carving - Gold Cancer
+8
925 Sterling Silver Gold Plated Constellation Open Toe Ring Adjustable Summer Beach Jewelry Rhinestone Inlaid Foot Ring
$8.23
No MOQ
 · 
10 sold recently
Free Shipping
925 Sterling Silver Toe Ring Women Minimalist Cuban Link Chain And Woven Mesh Design Fashion Sexy Summer Foot Jewelry
925 Sterling Silver Toe Ring Women Minimalist Cuban Link Chain And Woven Mesh Design Fashion Sexy Summer Foot Jewelry
like
Find Similar
Polished S925 sterling silver Cuban link toe ring for women in a minimalist style - Size 5/Cuban Link Texture / Silver
S925 sterling silver toe ring featuring an intricate hollow woven celtic knot design - Size 4/Hollow Woven Texture / Silver
925 Sterling Silver Toe Ring Women Minimalist Cuban Link Chain And Woven Mesh Design Fashion Sexy Summer Foot Jewelry
$10.22
No MOQ
 · 
65 views
Free Shipping
925 Sterling Silver Toe Rings For Women Minimalist Simple Plain Geometric Fine Band Open Foot Ring Gold Silver Jewelry
925 Sterling Silver Toe Rings For Women Minimalist Simple Plain Geometric Fine Band Open Foot Ring Gold Silver Jewelry
like
Find Similar
Minimalist S925 sterling silver toe ring with gold finish on a gray textured background - Gold
Minimalist S925 sterling silver open toe ring with polished mirror finish for women - Silver
925 Sterling Silver Toe Rings For Women Minimalist Simple Plain Geometric Fine Band Open Foot Ring Gold Silver Jewelry
-4%
$6.72
No MOQ
 · 
74 views
Free Shipping
Vintage Geometric Frog Eye Stainless Steel Ring For Men Women Fashion Commuter Gold Silver Color Finger Jewelry Accessory
Vintage Geometric Frog Eye Stainless Steel Ring For Men Women Fashion Commuter Gold Silver Color Finger Jewelry Accessory
like
Find Similar
Retro frog-shaped stainless steel ring in silver with a 45-degree angle top view - US 7 / Frog Shape / Steel
Vintage geometric round stainless steel ring with antique silver finish and dual beads - US 7 / Vintage Ball Shape / Antique Silver
Modern geometric wavy ring with decorative screw head accents in gold-plated steel - US 7 / Screw Wave Design / Gold
+18
Vintage Geometric Frog Eye Stainless Steel Ring For Men Women Fashion Commuter Gold Silver Color Finger Jewelry Accessory
$2.88-3.14
No MOQ
 · 
13 sold recently
Free Shipping
Men's Titanium Steel Ring Minimalist Geometric Brushed Electroplated Gold Black Blue Band Ring Personalized Fashion Jewelry Gift
Men's Titanium Steel Ring Minimalist Geometric Brushed Electroplated Gold Black Blue Band Ring Personalized Fashion Jewelry Gift
like
Find Similar
Detail of two-tone titanium ring showing gold brushed center and silver polished edges - US 6 / Gold
Detail of black brushed titanium steel ring with silver polished edges and beveled design - US 6 / Black
Minimalist silver and blue two-tone stainless steel ring for men with polished beveled edges - US 6 / Blue
+21
Men's Titanium Steel Ring Minimalist Geometric Brushed Electroplated Gold Black Blue Band Ring Personalized Fashion Jewelry Gift
-5%
$0.32-0.37
No MOQ
 · 
69 sold recently
Free Shipping
925 Sterling Silver Mobius Twisted Wave Toe Ring Open Adjustable Summer Beach Jewelry For Women
925 Sterling Silver Mobius Twisted Wave Toe Ring Open Adjustable Summer Beach Jewelry For Women
like
Find Similar
Minimalist S925 sterling silver Mobius wave ring with adjustable golden twist design - 925 Silver / Gold
925 Sterling Silver Mobius Twisted Wave Toe Ring Open Adjustable Summer Beach Jewelry For Women
$7.04
No MOQ
 · 
50 sold recently
Free Shipping
S925 Sterling Silver Minimalist Toe Ring For Women Gold Silver Plated Thin Band Simple Geometric Foot Jewelry Fashion Ring
S925 Sterling Silver Minimalist Toe Ring For Women Gold Silver Plated Thin Band Simple Geometric Foot Jewelry Fashion Ring
like
Find Similar
Minimalist S925 sterling silver toe ring with polished golden finish in slim design - 925 Silver / Gold
Minimalist S925 sterling silver open toe ring with polished mirror finish for women - 925 Silver / Platinum
S925 Sterling Silver Minimalist Toe Ring For Women Gold Silver Plated Thin Band Simple Geometric Foot Jewelry Fashion Ring
-22%
$6.47
No MOQ
Free Shipping
S925 Sterling Silver Toe Ring For Women Colorful Opal Adjustable Open Ring Geometric Simple Sexy Foot Jewelry Finger Ring
S925 Sterling Silver Toe Ring For Women Colorful Opal Adjustable Open Ring Geometric Simple Sexy Foot Jewelry Finger Ring
like
Find Similar
Elegant S925 sterling silver open toe ring with synthetic opal inlay for women - 925 Silver / White Gold
S925 Sterling Silver Toe Ring For Women Colorful Opal Adjustable Open Ring Geometric Simple Sexy Foot Jewelry Finger Ring
$12.31
No MOQ
Free Shipping
Vintage Tiger Head Ring Stainless Steel Relief Distressed Punk Gothic Hip Hop Couple Ring For Men Women Fashion Jewelry
Vintage Tiger Head Ring Stainless Steel Relief Distressed Punk Gothic Hip Hop Couple Ring For Men Women Fashion Jewelry
like
Find Similar
Regal tiger head ring in vintage gold finish with detailed 3D carving for men - US 7 / Gold
Retro stainless steel ring for men featuring a detailed 3D tiger head carving design - US 7 / Steel
+12
Vintage Tiger Head Ring Stainless Steel Relief Distressed Punk Gothic Hip Hop Couple Ring For Men Women Fashion Jewelry
-4%
$3.21-3.46
No MOQ
 · 
15 views
Free Shipping
Unisex Rainbow Titanium Steel Ring Fashion Polished Jewelry For Couples Pride Theme Band Ring Gift
Unisex Rainbow Titanium Steel Ring Fashion Polished Jewelry For Couples Pride Theme Band Ring Gift
like
Find Similar
Detailed view of 6mm rainbow stripe inlay on a polished silver stainless steel ring band - US 6 / Silver
Macro view of purple titanium steel ring with vibrant rainbow striped center inlay - US 6 / Purple
Polished golden stainless steel ring with colorful rainbow enamel stripe for pride - US 7 / Gold
Matte black titanium steel ring with textured rainbow stripes for men and women - US 7 / Black
+24
Unisex Rainbow Titanium Steel Ring Fashion Polished Jewelry For Couples Pride Theme Band Ring Gift
$0.73-1.26
No MOQ
 · 
246 sold recently
Free Shipping
925 Sterling Silver Maple Leaf Zirconia Adjustable Toe Ring Gold Plated Summer Beach Fashion Foot Jewelry For Women
925 Sterling Silver Maple Leaf Zirconia Adjustable Toe Ring Gold Plated Summer Beach Fashion Foot Jewelry For Women
like
Find Similar
Adjustable S925 sterling silver toe ring with maple leaf zircon inlay in gold finish - 925 Silver / Gold
925 Sterling Silver Maple Leaf Zirconia Adjustable Toe Ring Gold Plated Summer Beach Fashion Foot Jewelry For Women
$7.10
No MOQ
 · 
13 sold recently
Free Shipping
925 Sterling Silver Toe Ring For Women Minimalist Pave Rhinestone Foot Jewelry Adjustable Simple Silver Finger Ring Gift
925 Sterling Silver Toe Ring For Women Minimalist Pave Rhinestone Foot Jewelry Adjustable Simple Silver Finger Ring Gift
like
Find Similar
S925 sterling silver pave set cubic zirconia minimalist toe ring in silver finish - 925 Silver / Platinum
925 Sterling Silver Toe Ring For Women Minimalist Pave Rhinestone Foot Jewelry Adjustable Simple Silver Finger Ring Gift
-5%
$8.46
No MOQ
 · 
31 views
Free Shipping
925 Sterling Silver Toe Ring Open Adjustable Minimalist Multi Line Geometric Summer Foot Jewelry For Women
925 Sterling Silver Toe Ring Open Adjustable Minimalist Multi Line Geometric Summer Foot Jewelry For Women
like
Find Similar
Minimalist S925 sterling silver triple-layer open ring for women with polished finish - 925 Silver / Silver
925 Sterling Silver Toe Ring Open Adjustable Minimalist Multi Line Geometric Summer Foot Jewelry For Women
$12.31
No MOQ
Free Shipping
Vintage Horseshoe Titanium Steel Ring For Men Gold Silver Plated Rhinestone U-Shaped Geometric Finger Band Jewelry
Vintage Horseshoe Titanium Steel Ring For Men Gold Silver Plated Rhinestone U-Shaped Geometric Finger Band Jewelry
like
Find Similar
Brushed stainless steel horseshoe ring for men with 11 round cubic zirconia stones - US 7 / Steel
Men's gold plated titanium horseshoe ring with clear cubic zirconia stones in a bold design - US 7 / Gold
+12
Vintage Horseshoe Titanium Steel Ring For Men Gold Silver Plated Rhinestone U-Shaped Geometric Finger Band Jewelry
$2.75-3.01
No MOQ
 · 
26 views
Free Shipping
Vintage Stainless Steel Slave Chain Ring Set For Women Gold Butterfly Flower Star Zircon Double Finger Ring Jewelry
Vintage Stainless Steel Slave Chain Ring Set For Women Gold Butterfly Flower Star Zircon Double Finger Ring Jewelry
like
Find Similar
Detail view of gold butterfly chain double ring with bohemian textured coin patterns - Single Zircon and Bohemian Hollow Style (S-R874-A)
Vintage golden stainless steel double ring with floral design and chain link - Zircon Five-Petal Flower Link Style (S-R874-B)
Vintage gold stainless steel star chain ring set with multi-layer hollowed design - Star Embossed and Multi-Layer Hollow Style (S-R874-E)
Vintage Stainless Steel Slave Chain Ring Set For Women Gold Butterfly Flower Star Zircon Double Finger Ring Jewelry
-4%
$1.94-2.12
No MOQ
 · 
34 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
S925 Sterling Silver Adjustable Open Toe Ring For Women Gold Plated Twisted Pattern Summer Beach Foot Jewelry Minimalist Gift
S925 Sterling Silver Adjustable Open Toe Ring For Women Gold Plated Twisted Pattern Summer Beach Foot Jewelry Minimalist Gift
like
Find Similar
Minimalist S925 sterling silver golden open ring with adjustable spiral pattern design - 925 Silver / Gold
S925 Sterling Silver Adjustable Open Toe Ring For Women Gold Plated Twisted Pattern Summer Beach Foot Jewelry Minimalist Gift
$7.40
No MOQ
 · 
20 views
Free Shipping
925 Sterling Silver Toe Rings For Women Summer Beach Jewelry Adjustable Minimalist Multi Layer Wavy Open Rings Set Gold Silver
925 Sterling Silver Toe Rings For Women Summer Beach Jewelry Adjustable Minimalist Multi Layer Wavy Open Rings Set Gold Silver
like
Find Similar
Minimalist S925 sterling silver triple-layer open toe ring with a polished metallic finish - Adjustable Open / Platinum
Elegant 925 sterling silver triple wave open ring with gold plating for women - Adjustable Open / Gold
925 Sterling Silver Toe Rings For Women Summer Beach Jewelry Adjustable Minimalist Multi Layer Wavy Open Rings Set Gold Silver
-20%
$9.17
No MOQ
Free Shipping
Stainless Steel Adjustable Open Rings For Women Minimalist Aesthetic Heart Evil Eye Leaf Geometric Enamel Drip Oil Jewelry
Stainless Steel Adjustable Open Rings For Women Minimalist Aesthetic Heart Evil Eye Leaf Geometric Enamel Drip Oil Jewelry
like
Find Similar
Exaggerated silver leaf titanium steel open ring with adjustable olive branch design - Silver Leaf Shape Style (JR321)
Macro shot of polished silver hollow flower ring with elegant open adjustable band design - Silver Hollow Five-petal Flower Style (JR320)
Minimalist irregular textured silver stainless steel open ring with glossy finish - Silver Irregular Texture Style (JR318)
Detailed view of silver twisted croissant ring with a polished metallic finish - Silver French Croissant Twist Style (JR317)
+41
Stainless Steel Adjustable Open Rings For Women Minimalist Aesthetic Heart Evil Eye Leaf Geometric Enamel Drip Oil Jewelry
$0.45-1.04
No MOQ
 · 
64K+ sold recently
Top 1% Best Sellers
in Rings
Free Shipping
Adjustable Open Rings For Women Stainless Steel Gold Plated Colorful Enamel Heart Evil Eye Daisy Geometric Fashion Jewelry
Adjustable Open Rings For Women Stainless Steel Gold Plated Colorful Enamel Heart Evil Eye Daisy Geometric Fashion Jewelry
like
Find Similar
Macro detail of adjustable gold stainless steel ring with red enamel inlay and hammered texture - Deep Red Round Bohemian (J790)
Detailed close-up of gold stainless steel open ring with green turquoise inlay - Turquoise Round Disc Patchwork (J781)
Detail view of gold spiral ring with pastel purple white and pink enamel dots - Spiral Purple Blue White Round (J725)
Macro shot of gold stainless steel ring featuring a blue evil eye with sunburst rays - Evil Eye Sunburst (J780)
+10
Adjustable Open Rings For Women Stainless Steel Gold Plated Colorful Enamel Heart Evil Eye Daisy Geometric Fashion Jewelry
-5%
$0.87-1.32
No MOQ
 · 
7K+ sold recently
Top 1% Best Sellers
in Rings
Free Shipping
Men's Titanium Steel Ring Colorful Shell Inlay Stainless Steel Geometric Ring Jewelry Wholesale 36 Piece Mixed Box Set
Men's Titanium Steel Ring Colorful Shell Inlay Stainless Steel Geometric Ring Jewelry Wholesale 36 Piece Mixed Box Set
like
Find Similar
Bulk set of 36 stainless steel rings with colorful shell inlays in a white display box - US 7 / 36-Piece Multicolor Boxed Set
+6
Men's Titanium Steel Ring Colorful Shell Inlay Stainless Steel Geometric Ring Jewelry Wholesale 36 Piece Mixed Box Set
$17.82
No MOQ
 · 
23 sold recently
Minimalist 925 Sterling Silver Toe Ring For Women Gold Plated Adjustable Open Geometric Wave Design Beach Foot Jewelry Finger Ring
Minimalist 925 Sterling Silver Toe Ring For Women Gold Plated Adjustable Open Geometric Wave Design Beach Foot Jewelry Finger Ring
like
Find Similar
Minimalist S925 sterling silver open toe ring with adjustable gold plated cuff design - 925 Silver / Gold
Minimalist 925 Sterling Silver Toe Ring For Women Gold Plated Adjustable Open Geometric Wave Design Beach Foot Jewelry Finger Ring
$7.26
No MOQ
Free Shipping
S925 Sterling Silver Rhombus Open Toe Ring Adjustable Geometric Minimalist Sexy Foot Jewelry For Women Girls Accessories
S925 Sterling Silver Rhombus Open Toe Ring Adjustable Geometric Minimalist Sexy Foot Jewelry For Women Girls Accessories
like
Find Similar
Detailed macro view of S925 sterling silver gold plated ring with wave texture - Full S925 Sterling Silver / Gold
S925 sterling silver minimalist geometric rhombus open ring with hammered texture - Full S925 Sterling Silver / White Gold
S925 Sterling Silver Rhombus Open Toe Ring Adjustable Geometric Minimalist Sexy Foot Jewelry For Women Girls Accessories
$9.43
No MOQ
Free Shipping
Vintage Ancient Egyptian Symbol Spinner Ring Titanium Steel Horus Eye Ankh Relief Rotating Stress Relief Band Ring For Men Women
Vintage Ancient Egyptian Symbol Spinner Ring Titanium Steel Horus Eye Ankh Relief Rotating Stress Relief Band Ring For Men Women
like
Find Similar
Vintage titanium steel spinner ring with ancient Egyptian symbols for men and women - US 6 / Silver
Ancient Egyptian Eye of Horus spinner ring in gold finish stainless steel jewelry - US 6 / Gold
Macro shot of Egyptian symbols and matte finish on a rotatable titanium steel band - US 6 / Black
+18
Vintage Ancient Egyptian Symbol Spinner Ring Titanium Steel Horus Eye Ankh Relief Rotating Stress Relief Band Ring For Men Women
$2.59-3.01
No MOQ
 · 
13 sold recently
Free Shipping
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
like
Find Similar
Vintage silver-plated Chinese dragon open ring featuring intricate dragon scale textures - Silver Dragon Style
Vintage punk dragon claw ring in stainless steel with detailed scale texture on white background - Eagle Claw Shape
Detailed close-up of antique silver wolf head ring with vintage punk aesthetic carvings - Wolf Head Design
Vintage guitar style biomechanical men's ring in antique silver punk finish - Guitar Shape
+14
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
$0.05-0.58
No MOQ
 · 
37 sold recently
Vintage Titanium Steel Gemstone Ring For Men Women Retro Bohemian Turquoise Red Black Synthetic Ruby Inlaid Band Ring Jewelry
Vintage Titanium Steel Gemstone Ring For Men Women Retro Bohemian Turquoise Red Black Synthetic Ruby Inlaid Band Ring Jewelry
like
Find Similar
Retro stainless steel ring for men featuring a red gemstone and vintage silver finish - US 7 / Silver Band Red Gemstone
Vintage titanium steel ring featuring an oval turquoise stone and boho hollow patterns - US 7 / Steel Setting Turquoise
Vintage titanium steel ring featuring an oval black agate with retro hollow floral patterns - US 7 / Silver Band Black Gemstone
+21
Vintage Titanium Steel Gemstone Ring For Men Women Retro Bohemian Turquoise Red Black Synthetic Ruby Inlaid Band Ring Jewelry
-4%
$3.24
No MOQ
 · 
12 sold recently
Free Shipping
925 Sterling Silver Toe Ring For Women Pink Enamel Star Rhinestone Open Adjustable Summer Beach Vacation Fashion Jewelry
925 Sterling Silver Toe Ring For Women Pink Enamel Star Rhinestone Open Adjustable Summer Beach Vacation Fashion Jewelry
like
Find Similar
S925 sterling silver open toe ring with pink enamel star and sparkling zircon crystal - 925 Silver / Platinum (F054)
925 Sterling Silver Toe Ring For Women Pink Enamel Star Rhinestone Open Adjustable Summer Beach Vacation Fashion Jewelry
$7.65
No MOQ
Free Shipping
Stainless Steel Rings Purple Plated Geometric Titanium Steel Rings Rhinestone Glitter Shell Inlay Jewelry For Men Women
Stainless Steel Rings Purple Plated Geometric Titanium Steel Rings Rhinestone Glitter Shell Inlay Jewelry For Men Women
like
Find Similar
Three-piece purple titanium steel ring set with glitter and mineral stone inlays - US 6 / Purple
+7
Stainless Steel Rings Purple Plated Geometric Titanium Steel Rings Rhinestone Glitter Shell Inlay Jewelry For Men Women
$3.14
No MOQ
 · 
29 sold recently
Free Shipping
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
like
Find Similar
Minimalist silver textured ring with diamond-cut gear engraving for women's fashion - US 6 / Silver
Minimalist rose gold ring with hammered texture in an ultra-slim elegant design - US 6 / Rose Gold
Minimalist gold-plated slim ring featuring diamond-cut texture and elegant gear embossing - US 5 / Gold
+15
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
-5%
$0.75-0.87
No MOQ
 · 
15 sold recently
Free Shipping
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
like
Find Similar
Vintage punk dragon claw ring in stainless steel with detailed scale texture on white background - Eagle Claw
Detailed close-up of antique silver wolf head ring with vintage punk aesthetic carvings - Wolf Head
Vintage guitar style biomechanical men's ring in antique silver punk finish - Guitar
Detailed close-up of antique silver snake ring with textured scales and geometric head design - Silver Snake
+14
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
$0.05-0.58
No MOQ
 · 
51 sold recently
Vintage Men Retro Copper Ring Set Gothic Punk Adjustable Open Ring Antique Silver Gold Color Fox Cross Crown Ring Jewelry Gift
Vintage Men Retro Copper Ring Set Gothic Punk Adjustable Open Ring Antique Silver Gold Color Fox Cross Crown Ring Jewelry Gift
like
Find Similar
Vintage Thai silver style wide ring with kitsune relief and Celtic knot patterns - Adjustable Open / Kitsune Fox (J970)
Vintage silver stackable ring for men with golden crown relief and sparkling crystal inlay - Adjustable Open / Crown (J1306)
Men's vintage gothic cross ring in silver steel with geometric carved patterns - Adjustable Open / Cross (J982)
Close-up of vintage silver ring with engraved Chinese characters and adjustable open band - Adjustable Open / Eternal Happiness (J1205)
+10
Vintage Men Retro Copper Ring Set Gothic Punk Adjustable Open Ring Antique Silver Gold Color Fox Cross Crown Ring Jewelry Gift
$0.86-1.57
No MOQ
 · 
1 reviews
Free Shipping
Vintage Titanium Steel Feather Wing Open Ring Retro Punk Gothic Adjustable Band Ring For Men Women Fashion Jewelry
Vintage Titanium Steel Feather Wing Open Ring Retro Punk Gothic Adjustable Band Ring For Men Women Fashion Jewelry
like
Find Similar
Retro oxidized silver feather wing open ring made of durable titanium steel for men and women - US 7 / Steel
Retro titanium steel feather open ring with detailed wing texture for men and women - US 7 / Gold
+8
Vintage Titanium Steel Feather Wing Open Ring Retro Punk Gothic Adjustable Band Ring For Men Women Fashion Jewelry
-4%
$2.94-3.24
No MOQ
 · 
10 sold recently
Free Shipping
Minimalist Titanium Steel Band Ring For Men Women High Polished Contrast Color Epoxy Inlay Trendy Party Jewelry Finger Ring
Minimalist Titanium Steel Band Ring For Men Women High Polished Contrast Color Epoxy Inlay Trendy Party Jewelry Finger Ring
like
Find Similar
14 options
Minimalist Titanium Steel Band Ring For Men Women High Polished Contrast Color Epoxy Inlay Trendy Party Jewelry Finger Ring
-4%
$1.74
No MOQ
 · 
24 sold recently
Free Shipping
Minimalist Stainless Steel Rectangle Signet Ring For Men Women Vintage Oxidized Polished Titanium Steel Geometric Statement Ring
Minimalist Stainless Steel Rectangle Signet Ring For Men Women Vintage Oxidized Polished Titanium Steel Geometric Statement Ring
like
Find Similar
Macro view showing the glossy gold rectangular signet ring with high polished finish - US 7 / Gold
Minimalist matte black rectangular signet ring made of titanium steel in vintage style - US 7 / Black
Vintage oxidized titanium steel rectangular signet ring for men with industrial matte finish - US 7 / Antique Silver
Polished stainless steel rectangular signet ring for men in a minimalist vintage style - US 7 / Steel
+20
Minimalist Stainless Steel Rectangle Signet Ring For Men Women Vintage Oxidized Polished Titanium Steel Geometric Statement Ring
$2.75-3.14
No MOQ
 · 
17 sold recently
Free Shipping
Retro Bohemian Stainless Steel Ring For Men Women Vintage Turquoise Red Black White Stone Inlaid Celtic Knot Band Jewelry
Retro Bohemian Stainless Steel Ring For Men Women Vintage Turquoise Red Black White Stone Inlaid Celtic Knot Band Jewelry
like
Find Similar
Vintage stainless steel ring with oval white gemstone and Celtic knot design details - US 7 / White Stone
+23
Retro Bohemian Stainless Steel Ring For Men Women Vintage Turquoise Red Black White Stone Inlaid Celtic Knot Band Jewelry
$3.41
No MOQ
 · 
31 sold recently
Free Shipping
Vintage Stainless Steel Lion Head Ring For Men Punk Biker Domineering Red Rhinestone Eye Animal Finger Ring Fashion Jewelry
Vintage Stainless Steel Lion Head Ring For Men Punk Biker Domineering Red Rhinestone Eye Animal Finger Ring Fashion Jewelry
like
Find Similar
Silver lion head ring for men with vintage carving and red zircon eyes detail - US 7 / Steel
Men's vintage lion head ring with gold and silver finish and red zircon eyes - US 7 / Two-tone (Gold & Silver)
Bold lion head ring in gold finish with red zircon eyes and intricate mane texture - US 7 / Gold
Bold golden lion head ring with red rhinestone eyes in a polished punk rock style - US 7 / Gold Black
+41
Vintage Stainless Steel Lion Head Ring For Men Punk Biker Domineering Red Rhinestone Eye Animal Finger Ring Fashion Jewelry
$3.35
No MOQ
 · 
1 reviews
Free Shipping
Stainless Steel Greek Key Hollow Ring Geometric Great Wall Pattern Polished Band Ring For Men Women Fashion Jewelry Accessory
Stainless Steel Greek Key Hollow Ring Geometric Great Wall Pattern Polished Band Ring For Men Women Fashion Jewelry Accessory
like
Find Similar
Polished silver stainless steel Greek Key pattern ring with hollow geometric design - US 5 / Steel
Polished gold stainless steel men's ring with geometric cutout Greek fret pattern - US 5 / Gold
+10
Stainless Steel Greek Key Hollow Ring Geometric Great Wall Pattern Polished Band Ring For Men Women Fashion Jewelry Accessory
$2.10-2.36
No MOQ
 · 
32 sold recently
Free Shipping
Titanium Steel Band Ring For Men Women Beveled Edge Polished Brushed Minimalist Couple Ring Jewelry Gift Non-Fading
Titanium Steel Band Ring For Men Women Beveled Edge Polished Brushed Minimalist Couple Ring Jewelry Gift Non-Fading
like
Find Similar
Brushed stainless steel band ring in silver finish with polished bevelled edges - US 7 / 8mm / Steel Double Beveled Matte
Sleek minimalist purple stainless steel ring with a high-polished mirror finish - US 7 / 8mm / Purple Double Beveled Matte
Sleek 6mm blue polished stainless steel minimalist ring with beveled edges for men - US 7 / 8mm / Blue Double Beveled Matte
Macro view of a matte black smart health ring with sensor detail on satin - US 7 / 6mm / Black Beveled Polished
+154
Titanium Steel Band Ring For Men Women Beveled Edge Polished Brushed Minimalist Couple Ring Jewelry Gift Non-Fading
$0.08-0.50
No MOQ
 · 
177 sold recently
Titanium Steel Twist Ring For Men Women Croissant Spiral Design High Polished Wide Band Ring Jewelry Gift Black Gold Silver
Titanium Steel Twist Ring For Men Women Croissant Spiral Design High Polished Wide Band Ring Jewelry Gift Black Gold Silver
like
Find Similar
Detail of a vintage black croissant-style twisted rope ring with a high-polished finish - US 7 / Black
Detailed view of golden croissant ring with unique inner hollow geometric pattern - US 7 / Gold
Macro detail of silver titanium steel croissant ring with twisted texture and hollow interior - US 7 / Silver
+18
Titanium Steel Twist Ring For Men Women Croissant Spiral Design High Polished Wide Band Ring Jewelry Gift Black Gold Silver
-5%
$0.95-1.12
No MOQ
 · 
101 sold recently
Free Shipping
Modern Minimalist Copper Adjustable Ring For Women Ins Style Electroplated Silver Gold Finger Rings With Rhinestone Artificial Pearl Decoration
Modern Minimalist Copper Adjustable Ring For Women Ins Style Electroplated Silver Gold Finger Rings With Rhinestone Artificial Pearl Decoration
like
Find Similar
Bamboo-style 925 silver adjustable open rings in gold and silver finish with gems - Silver Bamboo Zircon (JZ1079)
Adjustable 925 sterling silver ring with shimmering stones worn on model finger - Silver Micro-Inlaid (JZ0846)
Minimalist 925 sterling silver open dome ring in polished silver finish for women - Silver Dome Open (JZ0960)
Close-up of minimalist adjustable 925 sterling silver ring worn on model's finger - Silver Simple Glossy (JZ0843)
+123
Modern Minimalist Copper Adjustable Ring For Women Ins Style Electroplated Silver Gold Finger Rings With Rhinestone Artificial Pearl Decoration
-4%
$0.80-1.89
No MOQ
 · 
387 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Vintage Stainless Steel Rhinestone Inlaid Ring For Men Women Emerald Cut Gemstone Grooved Band Fashion Jewelry Wedding Party Accessory
Vintage Stainless Steel Rhinestone Inlaid Ring For Men Women Emerald Cut Gemstone Grooved Band Fashion Jewelry Wedding Party Accessory
like
Find Similar
Vintage stainless steel ring featuring a rectangle emerald cut purple gemstone with grooved band - US 7 / Steel Color Purple Stone
Vintage silver steel ring with rectangle clear gemstone and black groove texture - US 7 / Steel Color White Stone
Silver stainless steel ring featuring a rectangular tiger eye stone with grooved band - US 7 / Silver Tiger Eye
Vintage stainless steel ring for men featuring horizontal stripes and black rectangle stone - US 7 / Silver Black Onyx
+50
Vintage Stainless Steel Rhinestone Inlaid Ring For Men Women Emerald Cut Gemstone Grooved Band Fashion Jewelry Wedding Party Accessory
$3.88
No MOQ
 · 
87 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access