Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

Popular collections in toe rings

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage Geometric Adjustable Rings For Women 18K Gold Plated Stainless Steel Natural Stone Retro Jewelry Bohemian Style
Vintage Geometric Adjustable Rings For Women 18K Gold Plated Stainless Steel Natural Stone Retro Jewelry Bohemian Style
like
Find Similar
Vintage 18k gold plated stainless steel ring with green malachite stones and tiered texture - Three Green Round Gemstones Style (HF-J1385)
Vintage 18k gold plated stainless steel ring with three pink oval natural stones - Pink Oval Gemstone Hollow Style (HF-J1455)
Retro 18k gold plated stainless steel ring with round green stone in sunburst design - Sunbeam Green Gemstone Style (HF-J1456)
18k gold-plated sunburst open ring featuring a blue stone in a retro celestial design - Blue Bead Starburst Shape Style (HF-J1457)
+25
Vintage Geometric Adjustable Rings For Women 18K Gold Plated Stainless Steel Natural Stone Retro Jewelry Bohemian Style
$2.05-2.82
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Rings
Free Shipping
French Minimalist 18K Gold Plated Stainless Steel Thin Ring For Women Geometric Twist Woven Checkered Texture Finger Ring Jewelry
French Minimalist 18K Gold Plated Stainless Steel Thin Ring For Women Geometric Twist Woven Checkered Texture Finger Ring Jewelry
like
Find Similar
Macro shot of 18K gold plated ring featuring textured geometric pattern on a velvet box - US 7 / Plaid Style / Gold
Minimalist 18K gold plated twisted rope ring for women on a beige jewelry box display - US 7 / Woven Style / Gold
+6
French Minimalist 18K Gold Plated Stainless Steel Thin Ring For Women Geometric Twist Woven Checkered Texture Finger Ring Jewelry
$1.52-1.78
No MOQ
 · 
37 sold recently
Free Shipping
Minimalist Stainless Steel Titanium Ring For Men Women Hip Hop Brushed Matte Polished Plain Band Ring Tungsten Carbide Style Daily Unisex Jewelry Gift
Minimalist Stainless Steel Titanium Ring For Men Women Hip Hop Brushed Matte Polished Plain Band Ring Tungsten Carbide Style Daily Unisex Jewelry Gift
like
Find Similar
Minimalist rose gold stainless steel ring with a polished mirror finish for women - US 5 / Polished Rose Gold (1mm)
Minimalist 12mm silver stainless steel band ring with high polish finish for men - 27-c-4 Steel-colored Outer Sphere 6mm (never Fades) / Size 5
Minimalist golden titanium steel ring displayed on a white marble base with green leaves - 27-c-3 Gold Outer Bulb 6mm (refundable And Exchangeable If Fading) / Size 5
Minimalist wide black stainless steel ring with polished mirror finish for men - 27-c-2 Black Outer Bulb 6mm (refundable And Exchangeable If It Fades) / Size 5
+257
Minimalist Stainless Steel Titanium Ring For Men Women Hip Hop Brushed Matte Polished Plain Band Ring Tungsten Carbide Style Daily Unisex Jewelry Gift
$0.08-0.39
No MOQ
 · 
56 sold recently
Free Shipping
Vintage Nordic Viking Rune Stainless Steel Ring For Men Black Silver Engraved Runic Totem Band Ring Polished Jewelry Gift
Vintage Nordic Viking Rune Stainless Steel Ring For Men Black Silver Engraved Runic Totem Band Ring Polished Jewelry Gift
like
Find Similar
Men's black stainless steel Viking ring with white Nordic Rune totem engraving - US 6 / Black
Silver stainless steel Viking ring with black engraved Nordic runes and polished finish - US 6 / Silver
+14
Vintage Nordic Viking Rune Stainless Steel Ring For Men Black Silver Engraved Runic Totem Band Ring Polished Jewelry Gift
$0.84
No MOQ
 · 
17 sold recently
Free Shipping
Vintage Punk Stainless Steel Ring For Men Dragon Scale Texture Evil Eye Tiger Eye Stone Turquoise Gothic Jewelry Finger Ring
Vintage Punk Stainless Steel Ring For Men Dragon Scale Texture Evil Eye Tiger Eye Stone Turquoise Gothic Jewelry Finger Ring
like
Find Similar
Detailed close-up of retro dragon scale ring featuring a vibrant red devil eye stone - US 8 / Red Eye
Macro detail of vintage dragon eye ring showing textured steel scales and tiger eye stone - US 8 / Yellow Eye
Macro shot of retro stainless steel ring with blue evil eye and scale texture - US 8 / Blue Evil Eye
Macro shot of gothic dragon scales ring featuring a mystical green dragon eye stone - US 8 / Green Eye
+31
Vintage Punk Stainless Steel Ring For Men Dragon Scale Texture Evil Eye Tiger Eye Stone Turquoise Gothic Jewelry Finger Ring
$2.88-3.14
No MOQ
 · 
18 sold recently
Free Shipping
Vintage Men's Stainless Steel Tiger Eye Ring Retro Punk Style Oval Gemstone Signet Ring For Men Jewelry Gift Accessory
Vintage Men's Stainless Steel Tiger Eye Ring Retro Punk Style Oval Gemstone Signet Ring For Men Jewelry Gift Accessory
like
Find Similar
Vintage punk men's stainless steel ring featuring oval tiger's eye stone and carved textures - US 7 / Steel
Detailed macro view of vintage stainless steel ring with tiger eye stone and gold filigree - US 7 / Two-tone (Gold & Silver)
+12
Vintage Men's Stainless Steel Tiger Eye Ring Retro Punk Style Oval Gemstone Signet Ring For Men Jewelry Gift Accessory
$4.98-5.50
No MOQ
Free Shipping
Vintage Signet Ring Titanium Steel Oval Gemstone Inlay Turquoise Tiger Eye Black Agate Men Unisex Retro Jewelry Gift
Vintage Signet Ring Titanium Steel Oval Gemstone Inlay Turquoise Tiger Eye Black Agate Men Unisex Retro Jewelry Gift
like
Find Similar
Retro stainless steel ring for men featuring an oval turquoise stone and silver finish - US 7 / Turquoise Style B
Vintage silver-tone titanium ring with an oval brown tiger eye gemstone for men - US 7 / Tiger's Eye
Silver signet ring with oval black onyx cabochon stone for men and women - US 9 / Black Gemstone
Vintage silver turquoise signet ring with oval black stone inlay for men - US 7 / Black
+44
Vintage Signet Ring Titanium Steel Oval Gemstone Inlay Turquoise Tiger Eye Black Agate Men Unisex Retro Jewelry Gift
$3.93
No MOQ
 · 
91 sold recently
Free Shipping
DIY Stainless Steel Ring Blanks With Groove For Inlay Handmade Jewelry Making Grooved Band Rings Unisex Polished Fashion Rings
DIY Stainless Steel Ring Blanks With Groove For Inlay Handmade Jewelry Making Grooved Band Rings Unisex Polished Fashion Rings
like
Find Similar
96 options
DIY Stainless Steel Ring Blanks With Groove For Inlay Handmade Jewelry Making Grooved Band Rings Unisex Polished Fashion Rings
$2.23
No MOQ
 · 
27 sold recently
Free Shipping
Minimalist Titanium Steel Stacked Rings For Women Gold Silver Plated Interlocking Circles Rhinestone Fashion Finger Ring
Minimalist Titanium Steel Stacked Rings For Women Gold Silver Plated Interlocking Circles Rhinestone Fashion Finger Ring
like
Find Similar
Stacked titanium steel rings set with gold and silver bands featuring three clear zircon gems - US 6 / Gold
Polished titanium steel interlinked stacking rings with sparkling zircon accents - US 6 / Silver
+8
Minimalist Titanium Steel Stacked Rings For Women Gold Silver Plated Interlocking Circles Rhinestone Fashion Finger Ring
$2.23
No MOQ
 · 
25 sold recently
Free Shipping
Gothic Bat Ring For Men Stainless Steel Retro Punk Animal Wrap Ring Halloween Party Vintage Oxidized Silver Jewelry Gift
Gothic Bat Ring For Men Stainless Steel Retro Punk Animal Wrap Ring Halloween Party Vintage Oxidized Silver Jewelry Gift
like
Find Similar
Retro bat wing gothic ring for men made of vintage silver stainless steel - US 7 / Steel
Gothic style black matte bat ring with detailed wings in punk stainless steel finish - US 7 / Black
+13
Gothic Bat Ring For Men Stainless Steel Retro Punk Animal Wrap Ring Halloween Party Vintage Oxidized Silver Jewelry Gift
$3.35-3.62
No MOQ
 · 
17 sold recently
Free Shipping
Adjustable Rings Zircon Sparkling Minimalist Korean Fashion Jewelry For Women
Adjustable Rings Zircon Sparkling Minimalist Korean Fashion Jewelry For Women
like
Find Similar
Detailed view of angel wing rings in rose gold, gold and silver finishes with crystals - Full Zirconia Wing / Platinum Color-Wing
Minimalist silver S925 sterling silver bow knot open ring with high polished finish - 3D Bow / Platinum Color-J384
Elegant rose gold bow open ring in S925 sterling silver with adjustable minimalist design - 3D Bow / Rose Gold-J384
Adjustable golden S925 sterling silver bow knot open ring with high polished finish - 3D Bow / Gold Color-J384
+65
Adjustable Rings Zircon Sparkling Minimalist Korean Fashion Jewelry For Women
-5%
$0.82-2.05
No MOQ
 · 
4K+ sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Minimalist Stainless Steel Signet Ring For Men Women Square Round Heart Geometric Polished Band Gold Silver Black Jewelry
Minimalist Stainless Steel Signet Ring For Men Women Square Round Heart Geometric Polished Band Gold Silver Black Jewelry
like
Find Similar
Polished gold square signet ring for men with 18mm flat round surface dimensions - US 6 / Gold (13-B-1)
Men's matte black square solid signet ring in stainless steel with 18mm flat round top - US 6 / Black (13-B-2)
Polished silver stainless steel signet ring with 18mm flat square surface for men - US 6 / Steel (13-B-3)
Polished gold heart signet ring in stainless steel with 15mm by 18mm face dimensions - US 6 / Gold Heart (13-C-1)
+210
Minimalist Stainless Steel Signet Ring For Men Women Square Round Heart Geometric Polished Band Gold Silver Black Jewelry
$1.02-1.40
No MOQ
Free Shipping
Rotatable Spinner Ring For Men Women Stainless Steel Minimalist Stress Relief Ring Cool Hip Hop Industrial Band Ring Jewelry
Rotatable Spinner Ring For Men Women Stainless Steel Minimalist Stress Relief Ring Cool Hip Hop Industrial Band Ring Jewelry
like
Find Similar
Men's two-tone rotating spinner ring in matte black and brushed silver stainless steel - US 6 / Black
Minimalist silver spinner ring for men made of polished stainless steel for stress relief - US 6 / Silver
+18
Rotatable Spinner Ring For Men Women Stainless Steel Minimalist Stress Relief Ring Cool Hip Hop Industrial Band Ring Jewelry
-5%
$0.57
No MOQ
 · 
32 sold recently
Vintage Titanium Steel Dragon Celtic Knot Ring For Men Women Punk Gothic Band Ring Blue Black Electroplated Fashion Jewelry
Vintage Titanium Steel Dragon Celtic Knot Ring For Men Women Punk Gothic Band Ring Blue Black Electroplated Fashion Jewelry
like
Find Similar
Mens stainless steel ring with black Celtic dragon pattern and silver bevelled edges - US 6 / Black
Detailed close-up of blue Celtic dragon inlay on men's stainless steel wedding ring - US 6 / Blue
+14
Vintage Titanium Steel Dragon Celtic Knot Ring For Men Women Punk Gothic Band Ring Blue Black Electroplated Fashion Jewelry
$0.60
No MOQ
 · 
45 sold recently
Free Shipping
Vintage Pentagram Titanium Steel Ring Retro Punk Gothic Finger Band For Men Women Hip Hop Fashion Jewelry Gift
Vintage Pentagram Titanium Steel Ring Retro Punk Gothic Finger Band For Men Women Hip Hop Fashion Jewelry Gift
like
Find Similar
Vintage punk titanium steel star ring with oxidized finish and vertical striped band - US 8 / Antique Silver
+4
Vintage Pentagram Titanium Steel Ring Retro Punk Gothic Finger Band For Men Women Hip Hop Fashion Jewelry Gift
-4%
$3.24
No MOQ
 · 
11 sold recently
Free Shipping
Punk Titanium Steel Fist Open Ring For Men Women Gothic Rock Streetwear Adjustable Stainless Steel Band Ring Jewelry Gift
Punk Titanium Steel Fist Open Ring For Men Women Gothic Rock Streetwear Adjustable Stainless Steel Band Ring Jewelry Gift
like
Find Similar
Retro silver fist shaped open ring in punk style made of polished stainless steel for men - US 7 / Steel
Polished gold stainless steel ring featuring detailed twin fist design with mirror reflection - US 7 / Gold
Macro shot of stainless steel ring featuring dual fist design with rainbow plating - US 7 / Rainbow
Detailed view of black polished stainless steel ring with two fists on an open band - US 7 / Black
+24
Punk Titanium Steel Fist Open Ring For Men Women Gothic Rock Streetwear Adjustable Stainless Steel Band Ring Jewelry Gift
$2.88-3.14
Mix MOQ : 3
Free Shipping
Minimalist Titanium Steel Geometric Signet Ring For Men Women Polished Plain Square Heart Arched Band Ring Jewelry Accessory
Minimalist Titanium Steel Geometric Signet Ring For Men Women Polished Plain Square Heart Arched Band Ring Jewelry Accessory
like
Find Similar
Polished 18K gold stainless steel signet ring with a geometric 3D V-shaped ridge pattern - US 6 / V-Ridge Square Style (13-B-4) / Gold
Minimalist silver stainless steel ring with 15mm square flat top and diagonal embossed line - US 6 / V-Ridge Square Style (13-B-5) / Silver
Men's matte black stainless steel square signet ring with geometric V-shape design 15mm - US 6 / V-Ridge Square Style (13-B-6) / Black
Minimalist stainless steel signet ring with a polished deep black finish for women - US 6 / Minimalist Smooth Square Style (13-C-7) / Black
+210
Minimalist Titanium Steel Geometric Signet Ring For Men Women Polished Plain Square Heart Arched Band Ring Jewelry Accessory
$1.02-1.40
No MOQ
 · 
16 sold recently
Free Shipping
925 Sterling Silver Open Rings For Women Irregular Lava Texture Minimalist Heart Moon Star Flower Adjustable Fashion Jewelry
925 Sterling Silver Open Rings For Women Irregular Lava Texture Minimalist Heart Moon Star Flower Adjustable Fashion Jewelry
like
Find Similar
Adjustable 925 sterling silver ring featuring organic lava texture and handmade finish - Irregular Lava Pleated Style (J7291)
Unique 925 sterling silver open ring with irregular lava texture and metallic finish - Irregular Pleated Texture Style (J7281)
Unique 925 sterling silver ring with handmade hammered texture and adjustable open band - Handmade Hammered Texture Style (J7289)
Handcrafted 925 sterling silver ring with organic hammered texture and small ring charm - Ring Pendant Hammered Texture Style (J7290)
+33
925 Sterling Silver Open Rings For Women Irregular Lava Texture Minimalist Heart Moon Star Flower Adjustable Fashion Jewelry
$0.73-0.92
No MOQ
 · 
11 sold recently
Free Shipping
Roman Numeral Cutout Inlaid Rhinestone Ring Titanium Steel Jewelry Gold Silver Color Minimalist Fashion Ring For Men Women
Roman Numeral Cutout Inlaid Rhinestone Ring Titanium Steel Jewelry Gold Silver Color Minimalist Fashion Ring For Men Women
like
Find Similar
Detailed close-up of gold-plated Roman numeral ring featuring sparkling cubic zirconia stones - US 7 / Gold
Detailed macro view of silver roman numeral ring with sparkling crystal inlay - US 7 / Silver
+10
Roman Numeral Cutout Inlaid Rhinestone Ring Titanium Steel Jewelry Gold Silver Color Minimalist Fashion Ring For Men Women
-5%
$0.45-0.55
No MOQ
 · 
36 sold recently
Free Shipping
Gothic Monster Fang Stainless Steel Ring For Men Retro Punk Titanium Steel Vampire Teeth Band Ring Personality Jewelry Gift
Gothic Monster Fang Stainless Steel Ring For Men Retro Punk Titanium Steel Vampire Teeth Band Ring Personality Jewelry Gift
like
Find Similar
6 options
Gothic Monster Fang Stainless Steel Ring For Men Retro Punk Titanium Steel Vampire Teeth Band Ring Personality Jewelry Gift
$3.14
No MOQ
Free Shipping
Stainless Steel Zirconia Heart Open Ring For Women Gold Plated Adjustable Retro Luxury Finger Ring Jewelry
Stainless Steel Zirconia Heart Open Ring For Women Gold Plated Adjustable Retro Luxury Finger Ring Jewelry
like
Find Similar
Macro shot showing dimensions and weight of a gold heart zirconia wrap ring - Clear Zirconia Wrap Style (XZ-R30555-WT)
Detailed size chart showing dimensions and weight of the gold heart gemstone ring - Colorful Zirconia Wrap Style (XZ-R30555-MX)
Detailed view of gold lava texture ring with colorful zircons and size specifications - Lava Texture Multicolored Gem Style (XZ-R30317-MX-8)
Detailed view of golden hammered ring with zircon inlays and product dimensions - Hammered White Zircon Wide Style (XZ-R30447-WT)
+2
Stainless Steel Zirconia Heart Open Ring For Women Gold Plated Adjustable Retro Luxury Finger Ring Jewelry
$2.49-2.61
No MOQ
 · 
16 sold recently
Free Shipping
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
like
Find Similar
Detailed macro view of a gold-plated stainless steel square link bracelet with crystals - Square Link Bracelet (39-E-9) / Gold
Detailed view of a rose gold stainless steel bracelet with crystal-set square links. - Square Link Bracelet (39-E-10) / Rose Gold
Macro detail of polished stainless steel square link bracelet with small inlaid stones - Square Link Bracelet (39-E-8) / Steel
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
$1.96-2.25
No MOQ
 · 
378 sold recently
Gothic Cross Titanium Steel Ring For Men Women Vintage Punk Biker Band Ring Silver Oxidized Finish Fashion Jewelry Gifts
Gothic Cross Titanium Steel Ring For Men Women Vintage Punk Biker Band Ring Silver Oxidized Finish Fashion Jewelry Gifts
like
Find Similar
Gothic style cross ring in silver titanium steel with vintage embossed flower details - US 7 / Silver
+5
Gothic Cross Titanium Steel Ring For Men Women Vintage Punk Biker Band Ring Silver Oxidized Finish Fashion Jewelry Gifts
$3.41
No MOQ
 · 
27 sold recently
Free Shipping
Vintage Stainless Steel 18K Gold Plated Locket Ring Openable Square Photo Box Ring Adjustable Rhinestone Star Clover Horseshoe Fortune Ring For Women Jewelry
Vintage Stainless Steel 18K Gold Plated Locket Ring Openable Square Photo Box Ring Adjustable Rhinestone Star Clover Horseshoe Fortune Ring For Women Jewelry
like
Find Similar
Detail of 18K gold stainless steel ring featuring a star pattern and sparkling stones - Star Moon Pattern (JDR0108015)
Detailed view of square 18K gold stainless steel ring with starburst pattern and zircon accents - Starburst Pattern (JDR0108016)
Detailed view of square gold stainless steel locket ring with green clover gemstones - Clover Pattern (JDR0308005)
Detail of waterproof stainless steel ring with horseshoe design and Fortune engraving - Horseshoe FORTUNE Pattern (JDR0308006)
Vintage Stainless Steel 18K Gold Plated Locket Ring Openable Square Photo Box Ring Adjustable Rhinestone Star Clover Horseshoe Fortune Ring For Women Jewelry
$6.16
No MOQ
 · 
72 views
Free Shipping
Vintage Stainless Steel Punk Ring For Men Women Gothic Lady Body Relief Carving Oxidized Band Ring Hip Hop Jewelry Gift
Vintage Stainless Steel Punk Ring For Men Women Gothic Lady Body Relief Carving Oxidized Band Ring Hip Hop Jewelry Gift
like
Find Similar
7 options
Vintage Stainless Steel Punk Ring For Men Women Gothic Lady Body Relief Carving Oxidized Band Ring Hip Hop Jewelry Gift
-4%
$3.21
No MOQ
Free Shipping
Adjustable Stainless Steel Rings With Artificial Pearl Shell Tiger Eye 18K Gold Plated Bohemian Retro For Women
Adjustable Stainless Steel Rings With Artificial Pearl Shell Tiger Eye 18K Gold Plated Bohemian Retro For Women
like
Find Similar
Macro view of gold-plated stainless steel flower ring with white pearl center and sizing info - Large Flower Pearl Style (NB-R24282)
Detailed view of gold plated stainless steel flower ring with white pearl inlay specs - Five-Petal Flower Pearl Style (NB-R24283)
Detail view of gold flower ring with pearl inlay showing 33mm diameter and 6.5g weight specs - Hollow Flower Pearl Single Layer (NB-R24287单层)
Detail showing dimensions and 5.8g weight of gold petal ring with white pearl - Leaf Pearl Style (NB-R24288)
+22
Adjustable Stainless Steel Rings With Artificial Pearl Shell Tiger Eye 18K Gold Plated Bohemian Retro For Women
$1.41-3.08
No MOQ
 · 
258 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
like
Find Similar
Iced out gold plated dollar sign hip hop ring for men with micro paved zircons - US 7 / Gold
+6
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
$3.41
No MOQ
 · 
10 sold recently
Free Shipping
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
like
Find Similar
Detailed view of wide gold ring featuring alternating polished and frosted textures - US 7 / Gold
Detail of silver men's ring with a frosted texture band and polished steel edges - US 7 / Silver
Detail view of black stainless steel ring with polished edges and matte meteorite texture - US 7 / Black
+15
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
-4%
$0.61-0.70
No MOQ
 · 
41 sold recently
Free Shipping
Vintage Oval Artificial Opal Ring For Women Stainless Steel Rhinestone Halo Ring Retro Fashion Finger Ring Birthday Gift Jewelry
Vintage Oval Artificial Opal Ring For Women Stainless Steel Rhinestone Halo Ring Retro Fashion Finger Ring Birthday Gift Jewelry
like
Find Similar
Classic vintage oval opal ring for women with halo diamonds and silver stainless steel band - US 5 / Iridescent Green Opal
Classic oval opal halo ring with sunflower design and shimmering blue violet fire - US 5 / Iridescent Blue Opal
+10
Vintage Oval Artificial Opal Ring For Women Stainless Steel Rhinestone Halo Ring Retro Fashion Finger Ring Birthday Gift Jewelry
$4.98
No MOQ
 · 
53 sold recently
Free Shipping
Vintage 316 Stainless Steel Wolf Head Ring For Men Women Polished Animal Finger Ring Punk Gothic Biker Jewelry Gift
Vintage 316 Stainless Steel Wolf Head Ring For Men Women Polished Animal Finger Ring Punk Gothic Biker Jewelry Gift
like
Find Similar
Polished black stainless steel wolf head ring with intricate engraved fur details - US 7 / Black
Polished stainless steel wolf head ring with realistic vintage black carvings for men - US 7 / Steel
Polished golden stainless steel wolf head ring with detailed animal carving texture - US 7 / Gold
+18
Vintage 316 Stainless Steel Wolf Head Ring For Men Women Polished Animal Finger Ring Punk Gothic Biker Jewelry Gift
$2.88-3.14
No MOQ
 · 
31 sold recently
Free Shipping
Fashionable Adjustable Open Rings Colorful Enamel Gold Plated Stainless Steel Vintage Boho Jewelry For Women Gift
Fashionable Adjustable Open Rings Colorful Enamel Gold Plated Stainless Steel Vintage Boho Jewelry For Women Gift
like
Find Similar
Detail view of gold layered ring with multi-row bands and black enamel texture - Multi-layer Enamel (ZJ185)
Vintage three-layer twisted gold ring with a round green stone and adjustable open band - Green Gem Shell (ZJ186)
Lava line enamel drip open ring in gold stainless steel with black and white accents - Colorful Liquid Enamel (ZJ188)
Detailed view of adjustable gold-plated ring with blue and white enamel beads - Blue White Beads (ZJ189)
+22
Fashionable Adjustable Open Rings Colorful Enamel Gold Plated Stainless Steel Vintage Boho Jewelry For Women Gift
-4%
$1.10
No MOQ
 · 
922 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Vintage Viking Celtic Knot Ring Men Titanium Steel Band Retro Nordic Hip Hop Stainless Steel Jewelry Gift Finger Ring
Vintage Viking Celtic Knot Ring Men Titanium Steel Band Retro Nordic Hip Hop Stainless Steel Jewelry Gift Finger Ring
like
Find Similar
Vintage stainless steel ring featuring silver Viking crow and Celtic knot relief patterns - US 7 / Scroll Celtic Knot Style (09308) / Steel
+6
Vintage Viking Celtic Knot Ring Men Titanium Steel Band Retro Nordic Hip Hop Stainless Steel Jewelry Gift Finger Ring
$2.83
No MOQ
 · 
18 sold recently
Free Shipping
Vintage Bohemian Adjustable Open Ring Stainless Steel Gold Plated Inlaid Natural Stone Turquoise Jewelry For Women Retro
Vintage Bohemian Adjustable Open Ring Stainless Steel Gold Plated Inlaid Natural Stone Turquoise Jewelry For Women Retro
like
Find Similar
Adjustable golden stainless steel ring with a round green malachite stone inlay - Malachite Style (ZN010-2)
Adjustable gold stainless steel ring with round white stone and hammered texture - White Jade Style (ZN010-3)
Adjustable golden stainless steel ring with round tiger eye stone and gear motif - Tiger Eye Style (ZN009-1)
Adjustable gold stainless steel ring with black round stone and sunflower sunburst pattern - Obsidian Style (ZN009-2)
+13
Vintage Bohemian Adjustable Open Ring Stainless Steel Gold Plated Inlaid Natural Stone Turquoise Jewelry For Women Retro
$1.34-1.53
No MOQ
 · 
334 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Minimalist Titanium Steel Signet Ring Square Mother Of Artificial Pearl Inlaid Geometric Finger Ring For Men Women Fashion Daily Jewelry Gold Silver Black
Minimalist Titanium Steel Signet Ring Square Mother Of Artificial Pearl Inlaid Geometric Finger Ring For Men Women Fashion Daily Jewelry Gold Silver Black
like
Find Similar
Polished titanium steel signet ring with square grey shell inlay for women - US 7 / Steel
Gold plated titanium steel ring with rectangular mother of pearl inlay on mirror surface - US 7 / Gold
Black titanium signet ring with square white mother of pearl inlay on gray background - US 7 / Black
+15
Minimalist Titanium Steel Signet Ring Square Mother Of Artificial Pearl Inlaid Geometric Finger Ring For Men Women Fashion Daily Jewelry Gold Silver Black
$3.41-3.67
No MOQ
Free Shipping
Vintage Stainless Steel Tree Of Life Ring For Men With Round Gemstone Retro Gothic Style Jewelry For Daily Party Gifts
Vintage Stainless Steel Tree Of Life Ring For Men With Round Gemstone Retro Gothic Style Jewelry For Daily Party Gifts
like
Find Similar
Vintage men's ring with red eyeball stone and tree of life engraving on silver band - US 7 / Steel Color Red Stone (Eye Pattern)
Macro shot of men's tiger eye ring with tree of life relief on silver band - US 7 / Steel Tiger Eye
Vintage male ring with oval orange gemstone and wood branch texture on tree bark - US 7 / Steel Red Agate
Detail of vintage silver ring with green gemstone on natural wood bark texture - US 7 / Silver Green Gemstone
+38
Vintage Stainless Steel Tree Of Life Ring For Men With Round Gemstone Retro Gothic Style Jewelry For Daily Party Gifts
$3.80
No MOQ
 · 
12 views
Free Shipping
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Oxidized Finish All-Seeing Eye Band Ring Fashion Jewelry Gift
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Oxidized Finish All-Seeing Eye Band Ring Fashion Jewelry Gift
like
Find Similar
7 options
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Oxidized Finish All-Seeing Eye Band Ring Fashion Jewelry Gift
$3.09
No MOQ
Free Shipping
Bohemian Evil Eye Heart Signet Ring Titanium Steel Gold Plated White Enamel Vintage Band For Women Fashion Accessories
Bohemian Evil Eye Heart Signet Ring Titanium Steel Gold Plated White Enamel Vintage Band For Women Fashion Accessories
like
Find Similar
Bohemian heart evil eye ring in 18k gold plated titanium steel with white enamel - US 6 / Gold
Bohemian 18k gold plated heart ring with white oil drip and evil eye motif - US 6 / Steel
+4
Bohemian Evil Eye Heart Signet Ring Titanium Steel Gold Plated White Enamel Vintage Band For Women Fashion Accessories
-5%
$3.43
No MOQ
Free Shipping
Men's Fashion Stainless Steel Carbon Fiber Ring Hip Hop Polished Mirror Finish Geometric Finger Ring For Teens Unisex Jewelry
Men's Fashion Stainless Steel Carbon Fiber Ring Hip Hop Polished Mirror Finish Geometric Finger Ring For Teens Unisex Jewelry
like
Find Similar
Polished silver stainless steel ring with a stylish black carbon fiber inlay design - Size 7 / Steel
Men's black titanium ring with carbon fiber inlay and polished finish detail - Size 7 / Black
+10
Men's Fashion Stainless Steel Carbon Fiber Ring Hip Hop Polished Mirror Finish Geometric Finger Ring For Teens Unisex Jewelry
$1.96-2.23
No MOQ
 · 
12 sold recently
Free Shipping
Premium Titanium Steel Interlocking Rings For Women 18K Gold Plated Rhinestone Stackable Geometric Roman Numeral Finger Rings
Premium Titanium Steel Interlocking Rings For Women 18K Gold Plated Rhinestone Stackable Geometric Roman Numeral Finger Rings
like
Find Similar
Detailed macro of silver interlocking triple ring set with five colorful gemstones - US 5 / Silver Base Rainbow Zircon Style
Macro detail of triple-interlocked 18K gold plated rings with five-color square crystals - US 5 / Golden Colored Diamond Style
Macro shot of 18K gold plated interlocking rings featuring Roman numerals and small zircons - US 5 / Silver Roman Style
Three-band interlocking gold titanium ring with Roman numerals and CZ diamonds - US 5 / Gold Roman Style
+56
Premium Titanium Steel Interlocking Rings For Women 18K Gold Plated Rhinestone Stackable Geometric Roman Numeral Finger Rings
-5%
$1.74-5.23
No MOQ
 · 
14 sold recently
Free Shipping
Men Stainless Steel Signet Ring Retro Punk Marijuana Leaf Pattern Polished Hip Hop Finger Ring Gold Silver Jewelry Gift
Men Stainless Steel Signet Ring Retro Punk Marijuana Leaf Pattern Polished Hip Hop Finger Ring Gold Silver Jewelry Gift
like
Find Similar
Polished stainless steel men's ring with golden maple leaf relief on black base - US 7 / Two-tone (Gold & Silver)
Polished stainless steel maple leaf ring for men with vintage embossed geometric pattern - US 7 / Steel
+12
Men Stainless Steel Signet Ring Retro Punk Marijuana Leaf Pattern Polished Hip Hop Finger Ring Gold Silver Jewelry Gift
$2.88-3.14
No MOQ
 · 
41 sold recently
Free Shipping
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
like
Find Similar
Elegant gold crown ring with pink marquise zircon and sparkling white crystals - Gold / Crown V-Shape Style (Style 1)
Adjustable gold flower ring with sparkling pink and purple cubic zirconia stones - Gold / Triple Flower Style (Style 2)
Slim gold-plated ring with colorful pavé crystals in a grey velvet jewelry box - Gold / Colorful Eternity Style (Style 3)
Floral butterfly ring in gold finish with pink green and white zircon stones - Gold / Flower Cluster Style (Style 4)
+42
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
$1.45-1.60
No MOQ
 · 
793 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Vintage Punk Flame Skull Stainless Steel Ring For Men Gothic Crown Design Personalized Hip Hop Biker Band Rings Jewelry Gift
Vintage Punk Flame Skull Stainless Steel Ring For Men Gothic Crown Design Personalized Hip Hop Biker Band Rings Jewelry Gift
like
Find Similar
Gothic flame skull ring in vintage stainless steel with mirrored reflection on black background - US 7 / Steel
Retro punk flame skull ring in stainless steel with silver, black and gold finishes - US 7 / Gold & Silver
+16
Vintage Punk Flame Skull Stainless Steel Ring For Men Gothic Crown Design Personalized Hip Hop Biker Band Rings Jewelry Gift
-5%
$3.48-3.73
No MOQ
 · 
17 sold recently
Free Shipping
Minimalist Titanium Steel Ring For Men Women Silver Black Double Groove Stripes Band Ring Wedding Fashion Jewelry
Minimalist Titanium Steel Ring For Men Women Silver Black Double Groove Stripes Band Ring Wedding Fashion Jewelry
like
Find Similar
8mm silver stainless steel men's ring with double black enamel stripes on white background - US 7 / Silver
+7
Minimalist Titanium Steel Ring For Men Women Silver Black Double Groove Stripes Band Ring Wedding Fashion Jewelry
-4%
$0.62
No MOQ
 · 
11 sold recently
Free Shipping
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
like
Find Similar
Macro shot of 8mm brushed silver ring with vibrant blue center groove and polished interior - US 7 / Silver & Blue
Detail of 8mm wide men's ring with matte black finish and polished blue inner band - US 7 / Black and Blue
8mm black brushed stainless steel ring with a polished gold center band for men - US 7 / Black and Gold
+21
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
-5%
$0.50-0.97
No MOQ
 · 
34 sold recently
Free Shipping
Vintage Stainless Steel Lion Head Ring For Men Punk Gothic Animal Relief Biker Ring Hip Hop Domineering Jewelry Accessories
Vintage Stainless Steel Lion Head Ring For Men Punk Gothic Animal Relief Biker Ring Hip Hop Domineering Jewelry Accessories
like
Find Similar
Vintage silver lion head ring in stainless steel with detailed punk gothic relief design - US 8 / Antique Silver
Macro shot of detailed lion head engraving on vintage golden stainless steel ring - US 8 / Gold
+12
Vintage Stainless Steel Lion Head Ring For Men Punk Gothic Animal Relief Biker Ring Hip Hop Domineering Jewelry Accessories
-4%
$2.87-3.24
No MOQ
 · 
12 sold recently
Free Shipping
Adjustable Open Ring Stainless Steel 18K Gold Plated Enamel Evil Eye Snake Flower Leaf Retro Bohemian Jewelry For Women
Adjustable Open Ring Stainless Steel 18K Gold Plated Enamel Evil Eye Snake Flower Leaf Retro Bohemian Jewelry For Women
like
Find Similar
18k gold plated open ring featuring black and white enamel leaf patterns for women - Black and White Twin Leaves
Colorful enamel heart open ring with 18k gold plating and adjustable band for women - Multicolor Hollow Heart
Minimalist double-layered 18k gold-plated open ring with green enamel finish - Green Double Layer Line
18k gold plated adjustable chain ring with pink and blue enamel detailing for women - Pink and Blue Chain
+7
Adjustable Open Ring Stainless Steel 18K Gold Plated Enamel Evil Eye Snake Flower Leaf Retro Bohemian Jewelry For Women
$1.81
No MOQ
 · 
282 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Punk Stainless Steel Dragon Claw Evil Eye Open Ring Gothic Vintage Eagle Claw Finger Ring For Men Women Gold Plated Jewelry
Punk Stainless Steel Dragon Claw Evil Eye Open Ring Gothic Vintage Eagle Claw Finger Ring For Men Women Gold Plated Jewelry
like
Find Similar
Punk titanium steel dragon claw ring with red mystical eye stone on a white background - US 7 / Gold Base Red
Gothic punk dragon claw ring in vintage gold with a purple evil eye gemstone - US 7 / Gold Base Purple
Punk style dragon claw ring with blue evil eye in gold stainless steel finish - US 7 / Gold Base Blue
Punk dragon claw ring in gold finish featuring a blue eye-shaped stone setting - US 7 / Gold Base Dark Blue
+38
Punk Stainless Steel Dragon Claw Evil Eye Open Ring Gothic Vintage Eagle Claw Finger Ring For Men Women Gold Plated Jewelry
$3.27
No MOQ
Free Shipping
Heart Gesture Stainless Steel Ring Women Adjustable Minimalist Gold Silver Rainbow Finger Jewelry Daily Party Dating Gift
Heart Gesture Stainless Steel Ring Women Adjustable Minimalist Gold Silver Rainbow Finger Jewelry Daily Party Dating Gift
like
Find Similar
Macro detail of silver stainless steel open ring featuring a unique pointing hands design - Silver
Macro shot of rainbow-colored titanium steel ring with creative heart gesture hand shape - Rainbow
Minimalist gold titanium steel open ring with creative heart hands gesture design - Gold
Heart Gesture Stainless Steel Ring Women Adjustable Minimalist Gold Silver Rainbow Finger Jewelry Daily Party Dating Gift
$0.50-0.78
Mix MOQ : 2
 · 
53 sold recently
Free Shipping
Cyberpunk Gear Ring Stainless Steel Punk Geometric Band Ring For Men Women Industrial Style Fashion Jewelry Gift
Cyberpunk Gear Ring Stainless Steel Punk Geometric Band Ring For Men Women Industrial Style Fashion Jewelry Gift
like
Find Similar
Detail shot of 7mm titanium steel gear ring featuring geometric pyramid texture - US 6 / Gold
Detail showing 7mm wide titanium steel ring with punk gear sawtooth texture - US 6 / Black
Detailed macro view of a 7mm titanium steel gear ring with industrial geometric patterns - US 6 / Silver
+21
Cyberpunk Gear Ring Stainless Steel Punk Geometric Band Ring For Men Women Industrial Style Fashion Jewelry Gift
-4%
$1.00-1.02
No MOQ
 · 
10 sold recently
Free Shipping
Vintage Titanium Steel Ring With Synthetic Turquoise Stone Bohemian Hollow Lotus Mandala Ethnic Antique Silver Ring For Women Men
Vintage Titanium Steel Ring With Synthetic Turquoise Stone Bohemian Hollow Lotus Mandala Ethnic Antique Silver Ring For Women Men
like
Find Similar
7 options
Vintage Titanium Steel Ring With Synthetic Turquoise Stone Bohemian Hollow Lotus Mandala Ethnic Antique Silver Ring For Women Men
$3.93
No MOQ
Free Shipping
Vintage Stainless Steel Ring For Women With 18K Gold Plating Natural Stone Zircon Snake Design Adjustable Open INS Style Jewelry
Vintage Stainless Steel Ring For Women With 18K Gold Plating Natural Stone Zircon Snake Design Adjustable Open INS Style Jewelry
like
Find Similar
Detailed size specifications for the gold ring with oval green stone inlay - Oval Green Gemstone Style (JDR2303018-GN)
Detail view of gold ring with oval white mother of pearl and product specifications - Oval White Mother of Pearl Style (JDR2303018-WT)
Golden stainless steel ring featuring an oval mother of pearl stone and double hollow band - Double Layer Hollow Oval Gemstone Style (JDR2303035)
Detailed view of snake-shaped hammered gold ring with green marquise gemstone eye - Snake Shape Open Green Eye Style (JDRW2303005-GN)
+4
Vintage Stainless Steel Ring For Women With 18K Gold Plating Natural Stone Zircon Snake Design Adjustable Open INS Style Jewelry
$1.96-3.93
No MOQ
 · 
75% reordered
Top 5% Best Sellers
in Rings
Free Shipping
Vintage Punk Tiger Eye Stone Stainless Steel Ring For Men Retro Signet Titanium Steel Band Ring Fashion Jewelry Gift
Vintage Punk Tiger Eye Stone Stainless Steel Ring For Men Retro Signet Titanium Steel Band Ring Fashion Jewelry Gift
like
Find Similar
Men's titanium steel ring with rectangular tiger eye stone on a reflective background - US 7 / Steel
Vintage gold tiger eye signet ring for men in stainless steel with polished finish - US 7 / Gold
Men's vintage tiger eye stone ring with black rectangular signet in stainless steel - US 7 / Black
+18
Vintage Punk Tiger Eye Stone Stainless Steel Ring For Men Retro Signet Titanium Steel Band Ring Fashion Jewelry Gift
$4.19-4.45
No MOQ
Free Shipping
Minimalist Titanium Steel Plain Band Ring For Men Women Polished Finish Gold Black Vintage Silver Color Jewelry Finger Ring
Minimalist Titanium Steel Plain Band Ring For Men Women Polished Finish Gold Black Vintage Silver Color Jewelry Finger Ring
like
Find Similar
Polished silver wide band ring with mirrored exterior and brushed steel interior finish - US 6 / Silver
Detailed view of a wide polished gold titanium steel ring with smooth surface finish - US 6 / Gold
Polished black wide band titanium ring for men with minimalist aesthetic on white background - US 6 / Black
Minimalist wide band stainless steel ring with vintage silver finish and industrial style - US 6 / Antique Silver
+24
Minimalist Titanium Steel Plain Band Ring For Men Women Polished Finish Gold Black Vintage Silver Color Jewelry Finger Ring
-5%
$1.00-1.37
No MOQ
Free Shipping
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
like
Find Similar
Mens silver stainless steel signet ring featuring a detailed tree of life relief on rock - US 7 / Silver
Gold stainless steel signet ring for men featuring a detailed tree of life relief design - US 7 / Gold
+12
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
$1.70-1.83
No MOQ
Free Shipping
Vintage Stainless Steel Gorilla Head Ring Men Punk Rock Animal Finger Jewelry Silver Carved Gorilla Biker Ring Masculine Accessory
Vintage Stainless Steel Gorilla Head Ring Men Punk Rock Animal Finger Jewelry Silver Carved Gorilla Biker Ring Masculine Accessory
like
Find Similar
Vintage stainless steel gorilla head punk ring for men with detailed silver texture - US 7 / Silver
+6
Vintage Stainless Steel Gorilla Head Ring Men Punk Rock Animal Finger Jewelry Silver Carved Gorilla Biker Ring Masculine Accessory
-4%
$3.24
No MOQ
 · 
46 sold recently
Free Shipping
Fashion Copper Colorful Zirconia Open Adjustable Ring For Women Gold Silver Plated Crystal Floral Cluster Finger Ring Jewelry
Fashion Copper Colorful Zirconia Open Adjustable Ring For Women Gold Silver Plated Crystal Floral Cluster Finger Ring Jewelry
like
Find Similar
Adjustable gold ring with marquise green crystals and white zircon stones in a floral design - Adjustable Open / Green (Light KC Gold)
Adjustable gold plated open ring with pear purple and round white cubic zirconia stones - Adjustable Open / Purple (Light KC Gold)
Adjustable gold open ring with multi-colored pear and round cut 3A cubic zirconia stones - Adjustable Open / Mixed Color (Light KC Gold)
Macro detail of adjustable silver ring featuring teardrop red and white crystals - Adjustable Open / Rose Red (White Gold)
+1
Fashion Copper Colorful Zirconia Open Adjustable Ring For Women Gold Silver Plated Crystal Floral Cluster Finger Ring Jewelry
$0.86
No MOQ
 · 
34 sold recently
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
like
Find Similar
Vintage oxidized silver fox ring with marcasite stones and unique wraparound design - US 7 / Antique Silver
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
-5%
$3.73
No MOQ
Free Shipping
Fashion Titanium Steel Adjustable Open Ring For Women Vintage Gold Plated Rhinestone Butterfly Wheat Ear Flower Heart Crown Finger Jewelry
Fashion Titanium Steel Adjustable Open Ring For Women Vintage Gold Plated Rhinestone Butterfly Wheat Ear Flower Heart Crown Finger Jewelry
like
Find Similar
Golden titanium steel leaf ring with blue gemstones and adjustable open band - Floral Blue Stone Style (JZ26-6)
Gold leaf-shaped adjustable ring in titanium steel set with sparkling zircons - Floral White Stone Style (JZ26-6)
Golden leaf ring with colorful pink, green and blue marquise stones in stainless steel - Floral Colorful Stones Style (JZ26-6)
Adjustable gold titanium steel ring featuring green marquise stones and leaf design - Floral Emerald Style (JZ26-6)
+42
Fashion Titanium Steel Adjustable Open Ring For Women Vintage Gold Plated Rhinestone Butterfly Wheat Ear Flower Heart Crown Finger Jewelry
$2.62
No MOQ
 · 
77% reordered
Top 3% Best Sellers
in Rings
Free Shipping
Fashion Stainless Steel Unisex Ring With Red Artificial Opal Inlay Minimalist Individual Drip Oil Polished Band Ring Jewelry
Fashion Stainless Steel Unisex Ring With Red Artificial Opal Inlay Minimalist Individual Drip Oil Polished Band Ring Jewelry
like
Find Similar
Polished black titanium steel ring featuring an inlaid red opal finish for men - US 6 / 4MM Black
Detail view of black titanium ring featuring vibrant red crushed faux opal inlay detail - US 6 / 6MM Black
Detailed side view of black titanium ring with vibrant red synthetic opal inlay - US 6 / 8MM Black
Macro detail of titanium steel ring featuring red synthetic opal inlay and polished finish - US 6 / 8MM Silver
+28
Fashion Stainless Steel Unisex Ring With Red Artificial Opal Inlay Minimalist Individual Drip Oil Polished Band Ring Jewelry
$0.84-0.92
No MOQ
 · 
20 sold recently
Free Shipping
Punk Gothic Skull Stainless Steel Ring For Men Rock Biker Evil Eye Rhinestone Finger Ring Retro Oxidized Jewelry Gift
Punk Gothic Skull Stainless Steel Ring For Men Rock Biker Evil Eye Rhinestone Finger Ring Retro Oxidized Jewelry Gift
like
Find Similar
Gothic skull ring in silver stainless steel with a round red ruby stone eye setting - US 7 / Steel Color Red Eye
Punk style stainless steel skull ring featuring a purple devil eye stone for men - US 7 / Steel Color Purple Eye
Punk gothic skull ring for men in stainless steel with a green evil eye gemstone - US 7 / Steel Color Green Eye
Gothic punk skull ring in vintage silver with a bright orange tiger eye stone - US 7 / Steel Color Yellow Eye
+45
Punk Gothic Skull Stainless Steel Ring For Men Rock Biker Evil Eye Rhinestone Finger Ring Retro Oxidized Jewelry Gift
$2.98
No MOQ
 · 
21 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access