Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

Popular collections in toe rings

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Minimalist Titanium Steel Rectangle Signet Ring For Men Women Polished Matte Retro Industrial Style Plain Band Finger Jewelry
Minimalist Titanium Steel Rectangle Signet Ring For Men Women Polished Matte Retro Industrial Style Plain Band Finger Jewelry
like
Find Similar
Minimalist black polished signet ring in rectangular titanium steel on stone texture - US 7 / Black
Minimalist gold rectangular signet ring in stainless steel with a sleek flat surface finish - US 7 / Gold
Vintage matte titanium steel signet ring with rectangle face on textured stone - US 7 / Antique Silver
Minimalist rectangular silver titanium steel signet ring with a polished flat top design - US 7 / Steel
+20
Minimalist Titanium Steel Rectangle Signet Ring For Men Women Polished Matte Retro Industrial Style Plain Band Finger Jewelry
$2.75-3.01
No MOQ
Free Shipping
Men's Retro Stainless Steel Ring Tiger Eye Carved Celtic Knot Pattern Punk Gothic Domineering Band Rings Fashion Jewelry Gift
Men's Retro Stainless Steel Ring Tiger Eye Carved Celtic Knot Pattern Punk Gothic Domineering Band Rings Fashion Jewelry Gift
like
Find Similar
4PCS set of men's vintage titanium steel rings with tiger eye stone and punk engravings - US 7 / Vintage Black Stone Signet and Scroll Pattern Wide Ring Set (SMTZ716)
+6
Men's Retro Stainless Steel Ring Tiger Eye Carved Celtic Knot Pattern Punk Gothic Domineering Band Rings Fashion Jewelry Gift
$5.50
No MOQ
Free Shipping
Minimalist Titanium Steel DIY Ring Blank Double Groove Design Hip Hop Finger Ring For Men Women Polished Jewelry
Minimalist Titanium Steel DIY Ring Blank Double Groove Design Hip Hop Finger Ring For Men Women Polished Jewelry
like
Find Similar
Men's black brushed stainless steel ring blank with U-shaped groove for DIY inlay crafts - US 7 / Black
Polished silver stainless steel ring blank with dual groove for DIY inlay crafting - US 7 / Silver
+12
Minimalist Titanium Steel DIY Ring Blank Double Groove Design Hip Hop Finger Ring For Men Women Polished Jewelry
$0.29-0.39
No MOQ
 · 
141 sold recently
Vintage Stainless Steel Crown Ring For Men Women Gothic Cross Fleur De Lis Rhinestone Inlaid Retro Punk Party Jewelry Band Ring
Vintage Stainless Steel Crown Ring For Men Women Gothic Cross Fleur De Lis Rhinestone Inlaid Retro Punk Party Jewelry Band Ring
like
Find Similar
Silver crown ring with ruby stones featuring cross and fleur-de-lis gothic patterns - US 7 / Steel Red Zircon
Vintage crown ring with black gemstones, cross and fleur-de-lis motifs in silver finish - US 7 / Steel Color Black Zircon
Detailed view of vintage silver crown ring featuring blue gems and cross cutout patterns - US 7 / Steel Dark Blue Zirconia
Silver crown ring with cross and iris patterns and light blue gemstones on white background - US 7 / Silver Light Blue Zirconia
+60
Vintage Stainless Steel Crown Ring For Men Women Gothic Cross Fleur De Lis Rhinestone Inlaid Retro Punk Party Jewelry Band Ring
-4%
$2.74
No MOQ
 · 
1 reviews
Free Shipping
Men's Stainless Steel Iron Cross Ring Vintage Biker Punk Gothic Lightning Pattern Band Ring Fashion Jewelry For Men
Men's Stainless Steel Iron Cross Ring Vintage Biker Punk Gothic Lightning Pattern Band Ring Fashion Jewelry For Men
like
Find Similar
Men's silver steel ring with black enamel iron cross and lightning bolt motifs - US 7 / Steel
Men's vintage gold stainless steel ring with black enamel cross and lightning symbols - US 7 / Gold
Men's retro stainless steel ring with red cross emblem and black punk finish - US 7 / Black
+18
Men's Stainless Steel Iron Cross Ring Vintage Biker Punk Gothic Lightning Pattern Band Ring Fashion Jewelry For Men
$3.62-3.88
No MOQ
 · 
1 reviews
Free Shipping
Vintage Gothic Punk Dragon Claw Evil Eye Stainless Steel Ring For Men Retro Hip Hop Biker Demon Eye Jewelry Accessories
Vintage Gothic Punk Dragon Claw Evil Eye Stainless Steel Ring For Men Retro Hip Hop Biker Demon Eye Jewelry Accessories
like
Find Similar
Gothic punk style devil eye ring with red dragon claw design and silver metal finish - US 7 / Silver Band Red Gemstone
Retro punk demon eye ring featuring a bold blue eyeball held by silver metal dragon claws - US 7 / Silver Band Green Gemstone
Gothic dragon claw ring with a blue eye stone in a polished metal finish for men - US 7 / Silver Tone Blue Eye
Punk style evil eye ring with orange resin eyeball and golden metal claw grip - US 7 / Gold Band Red Gemstone
+38
Vintage Gothic Punk Dragon Claw Evil Eye Stainless Steel Ring For Men Retro Hip Hop Biker Demon Eye Jewelry Accessories
-5%
$3.24-3.48
No MOQ
Free Shipping
Minimalist Copper Zirconia Stackable Ring For Women Gold Rose Gold Plated Line Design Micro Pave Finger Ring Fashion Jewelry
Minimalist Copper Zirconia Stackable Ring For Women Gold Rose Gold Plated Line Design Micro Pave Finger Ring Fashion Jewelry
like
Find Similar
Detail of gold stacking ring featuring micro-paved cubic zirconia and linear design - US 5 / Segmented Inlaid Style (JZ-473) / Gold
Macro shot of minimalist gold ring with micro-set zircon stone and claw setting detail - US 5 / Classic Claw Set Style (JZ-465) / Gold
Detailed close-up of a minimalist gold ring with marquise-shaped micro-pave zircon settings - US 5 / Marquise Hollow Style (JZ-469) / Gold
Close-up of gold wavy ring featuring micro-pave cubic zirconia on warm beige background - US 5 / Wave Fine Pave Style (JZ-471) / Gold
+200
Minimalist Copper Zirconia Stackable Ring For Women Gold Rose Gold Plated Line Design Micro Pave Finger Ring Fashion Jewelry
$0.79
No MOQ
 · 
207 sold recently
Free Shipping
Vintage Multi Layer Winding Titanium Steel Ring For Women Retro Hollow Band Jewelry Cross Over Line Design Stainless Steel Ring
Vintage Multi Layer Winding Titanium Steel Ring For Women Retro Hollow Band Jewelry Cross Over Line Design Stainless Steel Ring
like
Find Similar
6 options
Vintage Multi Layer Winding Titanium Steel Ring For Women Retro Hollow Band Jewelry Cross Over Line Design Stainless Steel Ring
-4%
$3.24
No MOQ
Free Shipping
Minimalist Stainless Steel Brushed Ring For Men Women Personalized Gold Blue Plated Band Niche Design Fashion Jewelry
Minimalist Stainless Steel Brushed Ring For Men Women Personalized Gold Blue Plated Band Niche Design Fashion Jewelry
like
Find Similar
Macro detail of brushed grey tungsten carbide ring with polished gold inner band - US 7 / Gold
Macro view of blue and silver tungsten carbide ring with brushed finish and inner engraving - US 7 / Blue
+14
Minimalist Stainless Steel Brushed Ring For Men Women Personalized Gold Blue Plated Band Niche Design Fashion Jewelry
$0.23-0.26
No MOQ
 · 
104 sold recently
Devil Eye Ring Stainless Steel Gothic Punk Claw Design For Men Evil Eyeball Jewelry Trendy Cool Gift Accessory
Devil Eye Ring Stainless Steel Gothic Punk Claw Design For Men Evil Eyeball Jewelry Trendy Cool Gift Accessory
like
Find Similar
Gothic punk devil eye ring with green eyeball and silver stainless steel claw band - US 7 / Light Green
Gothic silver stainless steel claw ring with a realistic red devil eye on white background - US 13 / Orange Red
Men's titanium steel ring featuring a blue evil eye design with sharp claw accents - US 9 / Steel Base Blue
Pink evil eye stainless steel ring with gothic claw setting design on white background - US 7 / Steel Base Pink
+24
Devil Eye Ring Stainless Steel Gothic Punk Claw Design For Men Evil Eyeball Jewelry Trendy Cool Gift Accessory
-4%
$3.24
No MOQ
 · 
78 sold recently
Free Shipping
Minimalist Punk Stainless Steel Signet Ring High Polished Smooth Round Surface Titanium Steel Band Ring For Men Women Jewelry
Minimalist Punk Stainless Steel Signet Ring High Polished Smooth Round Surface Titanium Steel Band Ring For Men Women Jewelry
like
Find Similar
Polished stainless steel punk style dome ring with smooth round signet top on wood background - US 7 / Steel
Polished gold stainless steel signet ring with a flat oval surface on black reflection - US 7 / Gold
Macro shot of polished black stainless steel signet ring with a smooth circular surface - US 7 / Black
Gold polished stainless steel oval signet ring with smooth mirror finish for men and women - US 7 / Rose Gold
+31
Minimalist Punk Stainless Steel Signet Ring High Polished Smooth Round Surface Titanium Steel Band Ring For Men Women Jewelry
$3.14-3.41
Mix MOQ : 3
Free Shipping
Vintage Adjustable Open Ring Stainless Steel Gold Plated Turquoise Evil Eye Enamel Geometric Jewelry Women
Vintage Adjustable Open Ring Stainless Steel Gold Plated Turquoise Evil Eye Enamel Geometric Jewelry Women
like
Find Similar
Detail of 18K gold-plated wide band ring with colorful zircons and hammered texture - Vintage Hammered Five-Color Gemstone
Adjustable gold leaf ring with green pavé crystals and polished stainless steel finish - Gold Leaf Green Zircon
Minimalist gold stainless steel open ring with an oval pink gemstone inlay - Simple Red Gemstone
Minimalist gold stainless steel open ring with green malachite stone and dotted relief texture - Gold Double Ring Malachite
+8
Vintage Adjustable Open Ring Stainless Steel Gold Plated Turquoise Evil Eye Enamel Geometric Jewelry Women
$1.18-3.01
No MOQ
 · 
190 sold recently
Free Shipping
Vintage Alloy Peacock Hollow Adjustable Open Ring For Women Retro Distressed Animal Feather Design Rhinestone Jewelry
Vintage Alloy Peacock Hollow Adjustable Open Ring For Women Retro Distressed Animal Feather Design Rhinestone Jewelry
like
Find Similar
Vintage hollow peacock open ring in retro silver alloy finish with adjustable band size - Silver
Vintage Alloy Peacock Hollow Adjustable Open Ring For Women Retro Distressed Animal Feather Design Rhinestone Jewelry
$0.73
Mix MOQ : 2
 · 
14 sold recently
Vintage Stainless Steel Cross Couple Rings Hollow Out Design For Men Women Black Silver Polished Brushed Wedding Jewelry Finger Ring
Vintage Stainless Steel Cross Couple Rings Hollow Out Design For Men Women Black Silver Polished Brushed Wedding Jewelry Finger Ring
like
Find Similar
Polished silver titanium steel ring with minimalist hollow cross design for couples - 5# / Steel Color Female Style
Minimalist black stainless steel ring featuring a 3D hollow cross design for couples - 5# / Black Women's Style
Brushed stainless steel ring with a hollowed-out cross design in silver finish - Size 7 / Steel Color Male Style
Brushed black stainless steel ring featuring a cutout cross design for men and women - Size 7 / Black Men's Style
+20
Vintage Stainless Steel Cross Couple Rings Hollow Out Design For Men Women Black Silver Polished Brushed Wedding Jewelry Finger Ring
$1.18-1.96
No MOQ
 · 
52 sold recently
Free Shipping
Vintage 304 Stainless Steel Snake Ring For Women Personality Retro Animal Scale Textured Antique Finish Jewelry Finger Ring
Vintage 304 Stainless Steel Snake Ring For Women Personality Retro Animal Scale Textured Antique Finish Jewelry Finger Ring
like
Find Similar
Vintage silver snake ring in surgical stainless steel with detailed scale texture - US 7 / Steel
Vintage golden snake ring in stainless steel with detailed scales on white background - US 7 / Gold
+8
Vintage 304 Stainless Steel Snake Ring For Women Personality Retro Animal Scale Textured Antique Finish Jewelry Finger Ring
$3.41-3.93
No MOQ
 · 
12 sold recently
Free Shipping
Men Fashion Stainless Steel Ring Fishbone Pattern Punk Style Vintage Band Ring For Men Women Jewelry Accessories Gift
Men Fashion Stainless Steel Ring Fishbone Pattern Punk Style Vintage Band Ring For Men Women Jewelry Accessories Gift
like
Find Similar
Close-up of 8mm stainless steel ring featuring a silver fishbone pattern inlay - US 6 / Silver Fish Bone
Close-up of 8mm stainless steel ring with golden fishbone pattern inlay on black enamel - US 6 / Gold Fishbone
Macro detail of 8mm black stainless steel ring featuring silver fishbone pattern inlay - US 6 / Black Plated Silver Fishbone
+21
Men Fashion Stainless Steel Ring Fishbone Pattern Punk Style Vintage Band Ring For Men Women Jewelry Accessories Gift
-3%
$0.50
No MOQ
 · 
59 sold recently
Minimalist Titanium Steel Stackable Ring For Men Women Polished High Gloss Geometric Simple Plain Band Jewelry Accessory
Minimalist Titanium Steel Stackable Ring For Men Women Polished High Gloss Geometric Simple Plain Band Jewelry Accessory
like
Find Similar
Polished 2.5mm gold titanium steel ring with a minimalist glossy mirror finish on white background - US 6 / Gold
Macro view of polished black stainless steel ring with a smooth mirror finish - US 6 / Black
Polished silver titanium steel cylinder ring with a smooth mirror finish and minimalist design - US 6 / Silver
+21
Minimalist Titanium Steel Stackable Ring For Men Women Polished High Gloss Geometric Simple Plain Band Jewelry Accessory
-5%
$0.70-0.75
No MOQ
Free Shipping
Minimalist Stainless Steel Plain Dome Ring High Polished Trendy Band For Men Women Hiphop Party Nightclub Individual Jewelry
Minimalist Stainless Steel Plain Dome Ring High Polished Trendy Band For Men Women Hiphop Party Nightclub Individual Jewelry
like
Find Similar
Polished silver minimalist round band ring shown from a 45-degree angle view - US 8 / Silver
Polished black minimalist circular ring with a smooth finish on a white display stand - US 8 / Black
Macro view of gold minimalist round smooth ring with polished surface and metallic luster - US 8 / Gold
+12
Minimalist Stainless Steel Plain Dome Ring High Polished Trendy Band For Men Women Hiphop Party Nightclub Individual Jewelry
$3.93-4.19
No MOQ
Free Shipping
Checkerboard Stainless Steel Titanium Ring Unisex 18K Gold Plated Minimalist Chic Finger Ring Enamel Drip Glaze Jewelry Gift
Checkerboard Stainless Steel Titanium Ring Unisex 18K Gold Plated Minimalist Chic Finger Ring Enamel Drip Glaze Jewelry Gift
like
Find Similar
Classic checkered black and white titanium steel ring with minimalist silver finish - US 6 / Silver
Classic 18K gold plated titanium steel ring with black and white checkered enamel design - US 6 / Gold
+14
Checkerboard Stainless Steel Titanium Ring Unisex 18K Gold Plated Minimalist Chic Finger Ring Enamel Drip Glaze Jewelry Gift
$2.36-2.62
No MOQ
Free Shipping
Stainless Steel Braided Twist Ring For Men Women High Polish Minimalist Rope Band Ring Personalized Unisex Hand Jewelry
Stainless Steel Braided Twist Ring For Men Women High Polish Minimalist Rope Band Ring Personalized Unisex Hand Jewelry
like
Find Similar
Polished stainless steel braided croissant dome ring with a thick twisted metal design - Size 7 / Steel
Polished golden braided rope twist ring made of high-quality stainless steel for women - Size 7 / Gold
+12
Stainless Steel Braided Twist Ring For Men Women High Polish Minimalist Rope Band Ring Personalized Unisex Hand Jewelry
$2.88-3.41
No MOQ
 · 
13 sold recently
Free Shipping
Vintage Punk Rings For Men Alloy Gothic Skull Dragon Animal Adjustable Open Band Biker Rock Hip Hop Jewelry
Vintage Punk Rings For Men Alloy Gothic Skull Dragon Animal Adjustable Open Band Biker Rock Hip Hop Jewelry
like
Find Similar
Retro skull and crossbones open ring in vintage silver finish for men - J107 Skull
Retro silver skull skeleton ring with gothic punk design and oxidized metal finish - J132 Skeleton
Retro silver snake ring with detailed scale texture in a vintage adjustable open design - J153 Snake
Retro black bat-wing open ring with matte finish and adjustable geometric design for men - J101 Black Bat
+74
Vintage Punk Rings For Men Alloy Gothic Skull Dragon Animal Adjustable Open Band Biker Rock Hip Hop Jewelry
$0.58-1.10
No MOQ
 · 
1K+ sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Elegant Zircon Butterfly Adjustable Open Rings Copper Luxury Fashion Jewelry Accessories Minimalist Gifts For Women
Elegant Zircon Butterfly Adjustable Open Rings Copper Luxury Fashion Jewelry Accessories Minimalist Gifts For Women
like
Find Similar
Chic 3-piece gold geometric ring set with black square stone on champagne silk fabric - Gold - 3pcs Set Black Gem
Detail of gold double-layer open ring featuring micro-pave cubic zirconia and chain link design - Adjustable Open / Gold - Double Layer Chain Zirconia
Detailed macro view of silver butterfly ring with micro-set zircon on twisted rope band - Adjustable Open / Silver - Bowknot Zirconia
Detailed shot of two gold-plated rings with micro-set zircons and a twisted texture - Adjustable Open Ring Set / Gold - 2pcs Set Pave CZ
+32
Elegant Zircon Butterfly Adjustable Open Rings Copper Luxury Fashion Jewelry Accessories Minimalist Gifts For Women
-86%
$0.35-1.39
No MOQ
 · 
177 sold recently
Free Shipping
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
like
Find Similar
5 options
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
$4.72
Mix MOQ : 2
Free Shipping
Minimalist Titanium Steel Ring Brushed Diagonal Grooved Band Ring For Men Women Fashion Industrial Style Jewelry Accessories
Minimalist Titanium Steel Ring Brushed Diagonal Grooved Band Ring For Men Women Fashion Industrial Style Jewelry Accessories
like
Find Similar
Minimalist brushed titanium steel ring featuring gold trim and diagonal groove textures - US 7 / Mixed Gold and Silver
Modern black and silver stainless steel ring with geometric brushed metal texture - US 7 / Two-Tone Black and Silver
+10
Minimalist Titanium Steel Ring Brushed Diagonal Grooved Band Ring For Men Women Fashion Industrial Style Jewelry Accessories
-5%
$1.49
No MOQ
Free Shipping
Vintage Stainless Steel Cupid Angel Relief Signet Ring For Women Retro Gold Plated Simple Fashion Jewelry Party Finger Ring
Vintage Stainless Steel Cupid Angel Relief Signet Ring For Women Retro Gold Plated Simple Fashion Jewelry Party Finger Ring
like
Find Similar
Gold vintage cupid relief signet ring in stainless steel with angel emblem detail - US 6 / Gold
+5
Vintage Stainless Steel Cupid Angel Relief Signet Ring For Women Retro Gold Plated Simple Fashion Jewelry Party Finger Ring
$3.35
No MOQ
 · 
15 views
Free Shipping
Stainless Steel Adjustable Chain Ring For Women PVD Gold Plated Waterproof Rhinestone Butterfly Geometric Finger Ring Jewelry
Stainless Steel Adjustable Chain Ring For Women PVD Gold Plated Waterproof Rhinestone Butterfly Geometric Finger Ring Jewelry
like
Find Similar
Detail of adjustable stainless steel chain ring featuring five purple zircon stones - Purple Five-Stone Style (JDR0312200)
Detail view of adjustable gold stainless steel ring with pink zircon and sliding bead - Pink Rectangle Stone Style (JDR0312201)
Detail view of adjustable gold butterfly ring with pink zircon and stainless steel chain - Pink Butterfly Style (JDR0312202)
Adjustable golden stainless steel ring with rectangular blue zircon and chain detail - Blue Rectangle Stone Style (JDR0312203)
+2
Stainless Steel Adjustable Chain Ring For Women PVD Gold Plated Waterproof Rhinestone Butterfly Geometric Finger Ring Jewelry
$2.36-3.27
No MOQ
 · 
1 reviews
Free Shipping
Handmade Vintage Dried Flower Resin Stainless Steel Ring Adjustable Open Floral Finger Ring For Women Fashion Jewelry Gift
Handmade Vintage Dried Flower Resin Stainless Steel Ring Adjustable Open Floral Finger Ring For Women Fashion Jewelry Gift
like
Find Similar
Handmade oil painting style dried flower ring with gold textured open stainless steel band - Green Base White Dried Flower Gold Band Style (A款)
Detail of oval silver ring featuring purple dried flowers and gold leaf inside the resin - Purple Dried Flower Silver Band Style (B款)
Close-up of handmade gold ring with pink resin, yellow dried flowers and hammered texture - Pink Base Yellow Dried Flower Gold Band Style (C款)
Close-up of handmade oval ring with blue dried flowers and silver hammered texture - White Base Blue Dried Flower Silver Band Style (D款)
Handmade Vintage Dried Flower Resin Stainless Steel Ring Adjustable Open Floral Finger Ring For Women Fashion Jewelry Gift
$3.67
Mix MOQ : 2
 · 
25 sold recently
Free Shipping
Vintage Distressed Titanium Steel Cross Ring With Celtic Knot Pattern Antique Silver Finish Unisex Gothic Punk Band Jewelry
Vintage Distressed Titanium Steel Cross Ring With Celtic Knot Pattern Antique Silver Finish Unisex Gothic Punk Band Jewelry
like
Find Similar
Macro shot of vintage 304 stainless steel ring with Celtic knot and cross engravings - US 7 / 8mm Cross
Detail of vintage 304 stainless steel cross ring with celtic knot and distressed finish - US 7 / 6mm Cross
+14
Vintage Distressed Titanium Steel Cross Ring With Celtic Knot Pattern Antique Silver Finish Unisex Gothic Punk Band Jewelry
$0.92
No MOQ
 · 
21 sold recently
Free Shipping
Stainless Steel Open Adjustable Ring 18K Gold Plated Natural Stone Mother Of Artificial Pearl Vintage Bohemian Jewelry For Women
Stainless Steel Open Adjustable Ring 18K Gold Plated Natural Stone Mother Of Artificial Pearl Vintage Bohemian Jewelry For Women
like
Find Similar
Golden hammered multi-strand open cuff bracelet with round tiger eye stone inlay - R01040-Gold Tiger Eye Hammered
18K gold plated multi-layer hammered open ring with oval white natural stone - R01041-Gold White Oval Stone Hammered
Golden multi-layer stainless steel ring with green marble stone and hammered texture - R01038-Gold Green Marble Texture
Gold layered cuff bracelet with pink oval gemstone and hammered texture on white background - R01039-Gold Pink Oval Stone
+25
Stainless Steel Open Adjustable Ring 18K Gold Plated Natural Stone Mother Of Artificial Pearl Vintage Bohemian Jewelry For Women
$2.41-3.93
Mix MOQ : 2
 · 
80% reordered
Top 5% Best Sellers
in Rings
Free Shipping
French Vintage 304 Stainless Steel Heart Evil Eye Open Ring For Women Personalized Fashion Adjustable Enamel Drip Oil Polished Finger Ring Jewelry
French Vintage 304 Stainless Steel Heart Evil Eye Open Ring For Women Personalized Fashion Adjustable Enamel Drip Oil Polished Finger Ring Jewelry
like
Find Similar
Detail of silver vintage heart ring with black enamel eye and 0.9cm width dimensions - Silver Band-Black Heart
Macro detail of vintage gold heart ring with enamel eye design on beige velvet - Gold Band-White Heart
Macro shot of vintage gold heart ring with black enamel and dimensions on silk - Gold Band-Black Heart
French Vintage 304 Stainless Steel Heart Evil Eye Open Ring For Women Personalized Fashion Adjustable Enamel Drip Oil Polished Finger Ring Jewelry
$0.78-1.05
Mix MOQ : 2
 · 
15 sold recently
Free Shipping
Vintage Gothic Stainless Steel Ring For Men Women Rhombic Square Zirconia Gemstone Hip Hop Punk Engraved Scroll Band Jewelry
Vintage Gothic Stainless Steel Ring For Men Women Rhombic Square Zirconia Gemstone Hip Hop Punk Engraved Scroll Band Jewelry
like
Find Similar
Punk vintage stainless steel ring with a square purple gemstone and retro floral texture - US 8 / Purple
Punk style stainless steel ring with square black gemstone and gothic relief textures - US 8 / Black
Detail of punk style stainless steel ring with orange gemstone and size 10 tag - US 8 / Yellow
Detail view of gothic steel ring with red square gemstone and size 8 tag - US 8 / Red
+16
Vintage Gothic Stainless Steel Ring For Men Women Rhombic Square Zirconia Gemstone Hip Hop Punk Engraved Scroll Band Jewelry
$3.93
No MOQ
Free Shipping
Vintage Bohemian Rings Alloy Carved Turquoise Opal Stone Ethnic Antique Silver Finish Stackable Finger Jewelry For Women
Vintage Bohemian Rings Alloy Carved Turquoise Opal Stone Ethnic Antique Silver Finish Stackable Finger Jewelry For Women
like
Find Similar
9-piece set of silver bohemian feather rings with turquoise stones for women - Turquoise Resort Style (3589-silver)
9-piece bohemian silver ring set with turquoise stones and vintage floral carvings - Retro Pale Green Opal-Look Style (6421-green)
11-piece vintage bohemian elephant and turquoise ring set in antique silver finish - Bohemian Totem Turquoise Style (4189)
Retro bohemian silver ring set featuring turquoise stones and ethnic elephant motifs - Sunflower Carved Turquoise Style (19606-silver)
+17
Vintage Bohemian Rings Alloy Carved Turquoise Opal Stone Ethnic Antique Silver Finish Stackable Finger Jewelry For Women
$0.65-2.02
Mix MOQ : 2
 · 
39 sold recently
Vintage Stainless Steel Wood Inlaid Ring For Men Gold Foil Cracked Texture Pattern Wide Band Fashion Jewelry Unisex Gift
Vintage Stainless Steel Wood Inlaid Ring For Men Gold Foil Cracked Texture Pattern Wide Band Fashion Jewelry Unisex Gift
like
Find Similar
Detailed shot of 8mm blue metallic ring with wood grain texture and gold wire inlay - US 6 / Blue
Detailed macro view of 8mm black matte ring with gold foil and wood grain inlay - US 6 / Black
Retro 8mm silver steel ring with brown wood grain inlay and gold foil marble texture - US 6 / Silver
Macro detail of 8mm gold ring featuring vintage wood grain and marble resin inlay - US 6 / Gold
+28
Vintage Stainless Steel Wood Inlaid Ring For Men Gold Foil Cracked Texture Pattern Wide Band Fashion Jewelry Unisex Gift
$0.92
No MOQ
 · 
18 views
Free Shipping
Stainless Steel Heart Ring Zebra Pattern Enamel Rhinestone Adjustable Open Ring Fashion Women Jewelry Gift
Stainless Steel Heart Ring Zebra Pattern Enamel Rhinestone Adjustable Open Ring Fashion Women Jewelry Gift
like
Find Similar
Macro detail of adjustable gold stainless steel ring with zebra enamel and zircons - Heart Zebra Print Rhinestone Style (JDR0306067)
Detail view of gold heart hollow ring with measurements 1.83cm diameter and 2.12g weight - Gold Hollow Heart Style (JDRW2305071) / Inner Diameter 1.83
Detail view of wavy gold-plated stainless steel ring with micro-set crystals - Wavy Gold Rhinestone Style (JDR0304018-7) / Inner Diameter 1.73
Stainless Steel Heart Ring Zebra Pattern Enamel Rhinestone Adjustable Open Ring Fashion Women Jewelry Gift
$1.83-5.11
No MOQ
 · 
1 reviews
Free Shipping
Vintage Owl Ring For Men Women Retro Copper Adjustable Open Ring With Colorful Eye Gothic Punk Animal Finger Jewelry Gift
Vintage Owl Ring For Men Women Retro Copper Adjustable Open Ring With Colorful Eye Gothic Punk Animal Finger Jewelry Gift
like
Find Similar
Vintage owl ring with detailed silver feathers and striking blue crystal eyes - Blue Vertical Eye Owl
Vintage owl ring for men featuring detailed silver-toned feathers and yellow owl eyes - Yellow Vertical Eye Owl
Vintage owl ring in silver finish with vibrant green gemstone eyes and feather texture - Green Round Eye Owl
Vintage owl ring with detailed silver feathers and striking large red gemstone eyes - Red Round Eye Owl
+5
Vintage Owl Ring For Men Women Retro Copper Adjustable Open Ring With Colorful Eye Gothic Punk Animal Finger Jewelry Gift
$1.13
No MOQ
 · 
21 sold recently
Free Shipping
Vintage 18K Gold Plated Stainless Steel Adjustable Ring Geometric Open Band Bohemian Fashion Jewelry For Women
Vintage 18K Gold Plated Stainless Steel Adjustable Ring Geometric Open Band Bohemian Fashion Jewelry For Women
like
Find Similar
Detail of adjustable 18K gold plated stainless steel ring with white beaded inlay inserts - 38-White Beaded
Detail of 18K gold-plated stainless steel lip-shaped ring with matte textured finish - 39-Gold Lips
Macro detail of adjustable 18K gold plated stainless steel floral ring on jewelry display - 40-Gold Flower
Close-up of 18K gold plated stainless steel ring with three clear zircon stones - 41-Triple Zircon
+36
Vintage 18K Gold Plated Stainless Steel Adjustable Ring Geometric Open Band Bohemian Fashion Jewelry For Women
$0.79-1.18
No MOQ
 · 
4K+ sold recently
Top 1% Best Sellers
in Rings
Free Shipping
Minimalist Stainless Steel Ring With Artificial Pearl Shell Inlay For Men And Women Unisex Couple Fashion Jewelry Finger Ring
Minimalist Stainless Steel Ring With Artificial Pearl Shell Inlay For Men And Women Unisex Couple Fashion Jewelry Finger Ring
like
Find Similar
Minimalist silver titanium steel ring set with white shell inlay and polished reflection - US 5 / Silver
Minimalist titanium steel rose gold couple rings set with white shell inlay for lovers - US 5 / Rose Gold
+8
Minimalist Stainless Steel Ring With Artificial Pearl Shell Inlay For Men And Women Unisex Couple Fashion Jewelry Finger Ring
$2.62-2.88
No MOQ
Free Shipping
Titanium Steel Men Rings Black Electroplated Grooved Brushed Mesh Bands Collection Jewelry For Daily Commute Male Accessary
Titanium Steel Men Rings Black Electroplated Grooved Brushed Mesh Bands Collection Jewelry For Daily Commute Male Accessary
like
Find Similar
Set of four 8mm black titanium steel rings for men including brushed and matte finishes - US 6 / Black
+7
Titanium Steel Men Rings Black Electroplated Grooved Brushed Mesh Bands Collection Jewelry For Daily Commute Male Accessary
$1.65
No MOQ
Free Shipping
Vintage Men Stainless Steel Ring Oval Natural Stone Inlaid Black Agate Tiger Eye Turquoise Geometric Punk Fashion Jewelry
Vintage Men Stainless Steel Ring Oval Natural Stone Inlaid Black Agate Tiger Eye Turquoise Geometric Punk Fashion Jewelry
like
Find Similar
Men's stainless steel ring with 1.75cm oval black onyx inlay and polished silver finish - US 7 / Large-Black Agate (RC-830SB)
Polished silver stainless steel signet ring with oval tiger eye stone inlay for men - US 7 / Large-Tiger Eye (RC-830SY)
Polished silver stainless steel ring for men with oval brown tiger eye stone inlay - US 7 / Tiger Eye (RC-829SY)
Polished silver stainless steel ring with a large oval black onyx stone for men - US 8 / Black Agate (RC-829SB)
+18
Vintage Men Stainless Steel Ring Oval Natural Stone Inlaid Black Agate Tiger Eye Turquoise Geometric Punk Fashion Jewelry
$3.67
No MOQ
 · 
17 sold recently
Free Shipping
Minimalist Stainless Steel Angel Wing Adjustable Open Ring For Women Men Fashion Personality Feather Design Finger Ring Jewelry
Minimalist Stainless Steel Angel Wing Adjustable Open Ring For Women Men Fashion Personality Feather Design Finger Ring Jewelry
like
Find Similar
Detail of adjustable golden wings ring showing delicate feather texture and metal finish - Double Wing (Gold)
Minimalist adjustable stainless steel wing ring in silver finish for women - Double Wing (Silver)
Macro detail of a black adjustable stainless steel wing ring in a jewelry box display - Double Wing (Black)
Minimalist Stainless Steel Angel Wing Adjustable Open Ring For Women Men Fashion Personality Feather Design Finger Ring Jewelry
$0.50-0.71
No MOQ
 · 
29 sold recently
Minimalist Stainless Steel Engraved Couple Ring For Men Women Infinity Forever Love His Queen Her King Rhinestone Band Jewelry
Minimalist Stainless Steel Engraved Couple Ring For Men Women Infinity Forever Love His Queen Her King Rhinestone Band Jewelry
like
Find Similar
Matte black stainless steel band ring with pinky swear graphic and I Love You engraving - 19-c-2 Black Promise 6mm Width / Size 7
Silver stainless steel pinky swear couple ring with I love you interior engraving - 19-c-1 Steel Color Promises 6mm Width / Size 7
Detailed macro view of a gold-plated titanium ring with a single centered round-cut gemstone - US 6 / Gold (11-A-1 6mm)
Detailed view of rose gold titanium ring with a flush-set round sparkling gemstone - US 6 / Rose Gold 6mm
+54
Minimalist Stainless Steel Engraved Couple Ring For Men Women Infinity Forever Love His Queen Her King Rhinestone Band Jewelry
$0.17-0.37
No MOQ
 · 
1 reviews
Free Shipping
Vintage Distressed Titanium Steel Ring For Men Women Eight Pointed Star Pattern Gothic Punk Finger Jewelry Retro Band Ring
Vintage Distressed Titanium Steel Ring For Men Women Eight Pointed Star Pattern Gothic Punk Finger Jewelry Retro Band Ring
like
Find Similar
Silver punk steel ring with black matte band and golden star patterns for men and women - US 7 / Gold & Silver
Punk style wide silver titanium steel ring featuring embossed octagonal star patterns - US 7 / Steel
+10
Vintage Distressed Titanium Steel Ring For Men Women Eight Pointed Star Pattern Gothic Punk Finger Jewelry Retro Band Ring
$3.14-3.41
No MOQ
Free Shipping
Vintage Scroll Totem Wide Band Ring Stainless Steel Men Distressed Gothic Punk Style Jewelry Beaded Edge
Vintage Scroll Totem Wide Band Ring Stainless Steel Men Distressed Gothic Punk Style Jewelry Beaded Edge
like
Find Similar
Vintage stainless steel wide ring with relief scroll pattern and brushed inner finish - US 13 / Silver
Men's wide titanium steel ring with vintage engraved totem pattern in silver finish - US 6 / Distressed Silver
Detailed view of vintage gold titanium ring with intricate black totem patterns - US 7 / Gold
+20
Vintage Scroll Totem Wide Band Ring Stainless Steel Men Distressed Gothic Punk Style Jewelry Beaded Edge
$1.26-1.39
No MOQ
 · 
195 sold recently
Free Shipping
Fingertip Nail Rings Zircon Butterfly Heart Crown Adjustable Copper Inlaid Luxury Elegant Jewelry For Women
Fingertip Nail Rings Zircon Butterfly Heart Crown Adjustable Copper Inlaid Luxury Elegant Jewelry For Women
like
Find Similar
Adjustable golden nail ring with double oval zircon pavé setting in modern style - Double Overlapping Oval Style (9913) / Light KC Gold
Luxury silver-toned zircon nail ring with overlapping oval hollow design for women - Overlapping Oval Pave Hollow Ring (9992) / White Gold
Geometric gold-plated double-layer nail ring with sparkling pave-set white zircons - Double-Layer Geometric Hollow Style (9859) / Light KC Gold
Geometric silver fingernail ring with sparkling rhinestones in an open-end design - Double-Layer Parallel Arch Style (9867) / White Gold
+75
Fingertip Nail Rings Zircon Butterfly Heart Crown Adjustable Copper Inlaid Luxury Elegant Jewelry For Women
-6%
$0.24-5.19
No MOQ
 · 
47 sold recently
Free Shipping
Vintage Punk Gothic Rings Collection For Men Ancient Silver Skull Snake Dragon Cross Eye Rhinestone Turquoise Hip Hop Jewelry
Vintage Punk Gothic Rings Collection For Men Ancient Silver Skull Snake Dragon Cross Eye Rhinestone Turquoise Hip Hop Jewelry
like
Find Similar
Close-up of vintage punk rings featuring skull, dragon and snake motifs in retro silver finish - Vintage Punk Style (06963) / Antique Silver
Vintage Punk Gothic Rings Collection For Men Ancient Silver Skull Snake Dragon Cross Eye Rhinestone Turquoise Hip Hop Jewelry
$4.43
No MOQ
 · 
22 sold recently
Vintage Owl Head Ring Titanium Stainless Steel Retro Punk Gothic Hip Hop Animal Band Rings For Men Party Jewelry
Vintage Owl Head Ring Titanium Stainless Steel Retro Punk Gothic Hip Hop Animal Band Rings For Men Party Jewelry
like
Find Similar
Vintage punk eagle head ring made of stainless steel with gothic owl feather details - US 7 / Steel
+6
Vintage Owl Head Ring Titanium Stainless Steel Retro Punk Gothic Hip Hop Animal Band Rings For Men Party Jewelry
$2.62
Mix MOQ : 3
Free Shipping
Skull Ring Stainless Steel Rhinestone Gothic Punk Retro Men Hip Hop Jewelry Gold Silver Halloween Individual Finger Ring
Skull Ring Stainless Steel Rhinestone Gothic Punk Retro Men Hip Hop Jewelry Gold Silver Halloween Individual Finger Ring
like
Find Similar
Punk style skull ring with golden filigree and black crystals on mirror reflection - US 7 / Gold Black
Gothic skull ring in silver and gold tones with blue gemstone eyes on black background - US 7 / Gold Blue
Gothic punk skull ring in vintage silver and gold with red gemstone accents and reflection - US 7 / Gold Red
+15
Skull Ring Stainless Steel Rhinestone Gothic Punk Retro Men Hip Hop Jewelry Gold Silver Halloween Individual Finger Ring
-5%
$4.73
No MOQ
Free Shipping
Minimalist Stainless Steel Brushed Ring For Men Polished Edge Matte Finish Groove Band Ring Punk Fashion Jewelry Finger Accessory Gift
Minimalist Stainless Steel Brushed Ring For Men Polished Edge Matte Finish Groove Band Ring Punk Fashion Jewelry Finger Accessory Gift
like
Find Similar
Men's matte black stainless steel ring with brushed center and polished edges - Black / US 7
Minimalist matte stainless steel ring with parallel grooves and polished edges for men - Silver / US 7
Men's wide gold stainless steel ring with matte brushed finish and polished edges - Gold / US 7
+12
Minimalist Stainless Steel Brushed Ring For Men Polished Edge Matte Finish Groove Band Ring Punk Fashion Jewelry Finger Accessory Gift
-5%
$1.49
No MOQ
 · 
20 sold recently
Free Shipping
Celtic Dragon Stainless Steel Ring Men Vintage Punk Band Fashion Hip Hop Jewelry Polished Inlay Accessory
Celtic Dragon Stainless Steel Ring Men Vintage Punk Band Fashion Hip Hop Jewelry Polished Inlay Accessory
like
Find Similar
Detail of silver titanium steel ring with intricate Celtic dragon pattern engraving - US 6 / Silver Black Silver
Detailed close-up of a black stainless steel ring with blue Celtic dragon inlay motif - US 6 / Black Blue Black
Detail of black stainless steel ring with silver Celtic dragon pattern inlay and polished finish - US 6 / Black Black Silver
Men's black titanium steel ring with gold dragon pattern inlay and polished finish - US 6 / Black Black Gold
+59
Celtic Dragon Stainless Steel Ring Men Vintage Punk Band Fashion Hip Hop Jewelry Polished Inlay Accessory
$0.51
No MOQ
 · 
2K+ sold recently
Top 1% Best Sellers
in Rings
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
like
Find Similar
Detail of gold titanium ring with square black gemstone and side groove textures - US 7 / Gold Tone Black Rhinestone
Men's titanium steel ring with a large red square gemstone and gold finish - US 7 / Gold with Red Rhinestones
Detail of square-cut blue gemstone and golden grooved band on men's titanium ring - US 7 / Gold Dark Blue Rhinestone
Detail of gold-plated signet ring featuring a large square-cut green gemstone and grooved band - US 7 / Gold Green Zirconia
+38
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
$3.14
No MOQ
Free Shipping
Punk Rock Middle Finger Gesture Ring For Men Titanium Steel Vintage Distressed Silver Hand Sign Ring Street Jewelry
Punk Rock Middle Finger Gesture Ring For Men Titanium Steel Vintage Distressed Silver Hand Sign Ring Street Jewelry
like
Find Similar
Retro punk rock middle finger gesture ring for men made of durable titanium steel - Style 1 / Size 7
Retro punk rock stainless steel middle finger ring for men in silver finish - Style 2 / Size 8
+8
NewPunk Rock Middle Finger Gesture Ring For Men Titanium Steel Vintage Distressed Silver Hand Sign Ring Street Jewelry
$3.41
No MOQ
 · 
10 sold recently
Free Shipping
Punk Two Tone Titanium Steel Lion King Crown Ring For Men Vintage Gothic Domineering Animal Jewelry Bold Biker Finger Ring
Punk Two Tone Titanium Steel Lion King Crown Ring For Men Vintage Gothic Domineering Animal Jewelry Bold Biker Finger Ring
like
Find Similar
Gothic lion head ring with gold crown detail in polished silver stainless steel - US 7 / Two-tone Gold Silver
+5
Punk Two Tone Titanium Steel Lion King Crown Ring For Men Vintage Gothic Domineering Animal Jewelry Bold Biker Finger Ring
$2.88
No MOQ
Free Shipping
Minimalist Stainless Steel Dome Ring For Women Men High Polished Plain Band Wedding Band Finger Jewelry Unisex Fashion Gift
Minimalist Stainless Steel Dome Ring For Women Men High Polished Plain Band Wedding Band Finger Jewelry Unisex Fashion Gift
like
Find Similar
116 options
Minimalist Stainless Steel Dome Ring For Women Men High Polished Plain Band Wedding Band Finger Jewelry Unisex Fashion Gift
-5%
$0.62-1.12
No MOQ
Free Shipping
Minimalist Stainless Steel Rhinestone Ring For Women Fashion Commuter Gold Rose Gold Silver Finger Ring Jewelry Gift
Minimalist Stainless Steel Rhinestone Ring For Women Fashion Commuter Gold Rose Gold Silver Finger Ring Jewelry Gift
like
Find Similar
Minimalist 2mm silver stainless steel ring for women with single zircon stone inlay - US 5 / 2mm Single Stone Style / Steel
Macro shot of a 2mm slim golden stainless steel ring featuring a small central diamond - US 5 / 2mm Single Stone Style / Gold
Minimalist 2mm wide rose gold titanium steel ring with a small round diamond - US 5 / 2mm Single Stone Style / Rose Gold
Elegant rose gold plated stainless steel ring featuring three sparkling inset diamonds - US 5 / Three Stones Inset Style / Rose Gold
+129
Minimalist Stainless Steel Rhinestone Ring For Women Fashion Commuter Gold Rose Gold Silver Finger Ring Jewelry Gift
$0.23-1.00
No MOQ
 · 
21 sold recently
Free Shipping
Vintage Stainless Steel Snake Ring For Men Women Gothic Punk Animal Statement Ring Rhinestone Goldstone Inlaid Jewelry
Vintage Stainless Steel Snake Ring For Men Women Gothic Punk Animal Statement Ring Rhinestone Goldstone Inlaid Jewelry
like
Find Similar
Vintage silver snake ring featuring a round blue sandstone with realistic scale textures - US 7 / Steel Color Black Rhinestone (Blue Goldstone)
Vintage punk snake ring with red oval gemstone and dragon scales on stainless steel - US 7 / Steel Red Zircon
+12
Vintage Stainless Steel Snake Ring For Men Women Gothic Punk Animal Statement Ring Rhinestone Goldstone Inlaid Jewelry
$3.62
No MOQ
Free Shipping
Fashion Light Luxury Interlocking Four-Piece Stacked Ring Set For Women Copper Cubic Zirconia Multi-Layer Finger Rings
Fashion Light Luxury Interlocking Four-Piece Stacked Ring Set For Women Copper Cubic Zirconia Multi-Layer Finger Rings
like
Find Similar
Interlinked multi-layered rings with sparkling cubic zirconia pavé in gold and silver finish - US 6 / Gold and Silver Stacked 4-Piece Set (Style 1)
+4
Fashion Light Luxury Interlocking Four-Piece Stacked Ring Set For Women Copper Cubic Zirconia Multi-Layer Finger Rings
-5%
$1.89
Mix MOQ : 2
 · 
11 sold recently
Free Shipping
Vintage Viking Celtic Knot Titanium Steel Ring For Men Women Retro Braided Pattern Band Ring Fashion Ethnic Style Jewelry
Vintage Viking Celtic Knot Titanium Steel Ring For Men Women Retro Braided Pattern Band Ring Fashion Ethnic Style Jewelry
like
Find Similar
Vintage Viking Celtic knot braided texture ring in silver steel on black background - US 8
+4
Vintage Viking Celtic Knot Titanium Steel Ring For Men Women Retro Braided Pattern Band Ring Fashion Ethnic Style Jewelry
$3.14
No MOQ
 · 
10 sold recently
Free Shipping
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
like
Find Similar
6-piece men's black titanium steel ring set with square signet and matte finishes - US 6 / Retro Punk Style (SMTZ215)
6-piece set of men's black titanium steel rings featuring vintage punk and matte designs - US 6 / Modern Industrial Style (SMTZ216)
+14
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
$4.58-5.50
No MOQ
Free Shipping
Skull Ring Stainless Steel Vintage Gothic Punk Biker Jewelry Carved Cross Octopus Heavy Metal Fashion For Men Women
Skull Ring Stainless Steel Vintage Gothic Punk Biker Jewelry Carved Cross Octopus Heavy Metal Fashion For Men Women
like
Find Similar
Macro detail of gothic skull ring with crown of thorns in vintage silver finish - 22501 / US Size 7
Macro shot of Gothic skull ring featuring detailed octopus tentacles in silver stainless steel - 23307 / US Size 7
Detailed view of vintage punk skull ring with horns in antique silver stainless steel - 22107 / US Size 7
Macro detail of vintage punk gothic ram skull ring in aged silver finish stainless steel - 22103 / US Size 7
+160
Skull Ring Stainless Steel Vintage Gothic Punk Biker Jewelry Carved Cross Octopus Heavy Metal Fashion For Men Women
$3.54-4.14
Mix MOQ : 2
 · 
218 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Vintage Viking Wolf Head Ring For Men Stainless Steel Gothic Punk Totem Band Ring Silver Gold Two Tone Biker Jewelry
Vintage Viking Wolf Head Ring For Men Stainless Steel Gothic Punk Totem Band Ring Silver Gold Two Tone Biker Jewelry
like
Find Similar
Vintage stainless steel wolf head ring with retro finish and Nordic textured detailing - US 7 / Steel
Vintage stainless steel lion head ring for men with golden embossed details and carvings - US 7 / Two-tone (Gold & Silver)
+12
Vintage Viking Wolf Head Ring For Men Stainless Steel Gothic Punk Totem Band Ring Silver Gold Two Tone Biker Jewelry
-5%
$3.24-3.48
No MOQ
 · 
16 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access