Everful

Wholesale travel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Travel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

All products in travel bottles

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Makeup Brush Holder PU Leather Glitter Cylindrical Cosmetic Storage Tube Portable Desktop Organizer Vanity Decor For Women
Makeup Brush Holder PU Leather Glitter Cylindrical Cosmetic Storage Tube Portable Desktop Organizer Vanity Decor For Women
like
Find Similar
Sparkling pink makeup brush holder with glitter finish for dressing table storage - Pink Glitter Bucket / Standard Size
Sparkling black and gold sequin makeup brush holder cylinder for desk storage - Black Glitter Bucket / Standard Size
Pink sequin cylindrical makeup brush holder with sparkling glitter finish for vanity desk - Light Pink Glitter Bucket / Standard Size
Sparkly orange glitter makeup brush holder with pink lining for vanity organizers - Yellow Glitter Bucket / Standard Size
+6
Makeup Brush Holder PU Leather Glitter Cylindrical Cosmetic Storage Tube Portable Desktop Organizer Vanity Decor For Women
$1.61-2.01
No MOQ
 · 
30 sold recently
Vintage Corduroy Makeup Bag Floral Polka Dot Print Cosmetic Organizer Portable Travel Wash Pouch Soft Storage For Women
Vintage Corduroy Makeup Bag Floral Polka Dot Print Cosmetic Organizer Portable Travel Wash Pouch Soft Storage For Women
like
Find Similar
Vintage corduroy makeup bag with heart patterns and woven label on white fabric - Corduroy Green Heart Makeup Bag
Vintage corduroy makeup bag with green tulip floral pattern and brand logo tag - Corduroy Floral Makeup Bag
Detail of vintage floral corduroy makeup bag with fine ribbed texture and woven label - Corduroy Rose Makeup Bag
Detail of green corduroy makeup bag with pink floral patterns and silver zipper on a wooden desk - Corduroy Cherry Blossom Makeup Bag
+19
Vintage Corduroy Makeup Bag Floral Polka Dot Print Cosmetic Organizer Portable Travel Wash Pouch Soft Storage For Women
$2.02
No MOQ
 · 
27 sold recently
Portable Round Folding Makeup Mirror Metal With Crystal Double Sided Magnifying Compact Purse Mirror For Travel Elegant
Portable Round Folding Makeup Mirror Metal With Crystal Double Sided Magnifying Compact Purse Mirror For Travel Elegant
like
Find Similar
Elegant gold-framed round makeup mirror with black faceted crystal inlay on dual-tone base - Gold Crystal Black
Golden folding pocket mirror with a large blue crystal on a tri-color background - Gold Crystal Light Blue
Portable golden metal makeup mirror featuring a large multifaceted blue crystal on the lid - Gold Crystal Royal Blue
Detail of round golden folding mirror with a large faceted green gemstone inlay - Gold Crystal Green
+7
Portable Round Folding Makeup Mirror Metal With Crystal Double Sided Magnifying Compact Purse Mirror For Travel Elegant
$0.29-1.24
No MOQ
 · 
132 sold recently
Portable Mesh Makeup Bag Nylon Breathable Transparent Zipper Closure Travel Cosmetic Toiletry Storage Organizer
Portable Mesh Makeup Bag Nylon Breathable Transparent Zipper Closure Travel Cosmetic Toiletry Storage Organizer
like
Find Similar
Small lavender mesh travel pouch for makeup brushes with zip closure and purple trim - Regular / Purple
Portable black mesh travel pouch with zipper for cosmetics and small accessories - Thickened / Black
Pink and white mesh travel pouch for makeup brushes with a secure silver zipper - Regular / Pink
Minimalist black mesh travel organizer bag for makeup brushes and small toiletries - Regular / Black
+1
NewPortable Mesh Makeup Bag Nylon Breathable Transparent Zipper Closure Travel Cosmetic Toiletry Storage Organizer
$0.92
No MOQ
PU Leather Makeup Brush Holder Tube Cylinder Cosmetic Storage Bucket Portable Travel Organizer With Snap Button
PU Leather Makeup Brush Holder Tube Cylinder Cosmetic Storage Bucket Portable Travel Organizer With Snap Button
like
Find Similar
White marble pattern PU leather makeup brush holder cylinder with dimensions 17.5x6.8 cm - Marble
Navy blue PU leather makeup brush holder with golden stars and star pattern detail - Blue with Stars
Pink PU leather makeup brush holder cylinder with lychee texture and snap closure - Pink
Cylindrical silver PU leather makeup brush holder with a metallic snap button - Silver
+2
PU Leather Makeup Brush Holder Tube Cylinder Cosmetic Storage Bucket Portable Travel Organizer With Snap Button
$2.16-2.45
Mix MOQ : 3
 · 
66 views
Drawstring Storage Bag Polyester Seersucker Texture Cartoon Animal Print Portable Travel Cosmetic Pouch Toiletries Organizer
Drawstring Storage Bag Polyester Seersucker Texture Cartoon Animal Print Portable Travel Cosmetic Pouch Toiletries Organizer
like
Find Similar
Cute bunny seersucker drawstring bag in cream white with heart and bow patterns - Blue Dress Rabbit
Cute waffle fabric drawstring pouch with blue diamond pattern and tiny black bows - Diamond Bear
Blue and white striped drawstring bag with vintage cartoon bear and floral patterns - Badge Bear
Cute cartoon drawstring storage bag in white popcorn fabric with bear and strawberry print - Lace Pastry
+13
NewDrawstring Storage Bag Polyester Seersucker Texture Cartoon Animal Print Portable Travel Cosmetic Pouch Toiletries Organizer
-5%
$0.54
No MOQ
Handheld Heart Shaped Makeup Mirror Acetate Portable Pocket Vanity Mirror With Handle Marble Tortoise Pattern Aesthetic
Handheld Heart Shaped Makeup Mirror Acetate Portable Pocket Vanity Mirror With Handle Marble Tortoise Pattern Aesthetic
like
Find Similar
Chic heart-shaped handheld mirror with colorful terrazzo patterns in an aesthetic setting - Pattern Mixed Color
Portable heart-shaped makeup mirror with vintage colorful marble pattern and handle - Marbled Purple
Portable heart-shaped hand mirror with cyan marble pattern acetic acid frame - Fresh Green
Heart shaped acetate mirror with colorful marble pattern and short handle design - Aurora Green
+6
Handheld Heart Shaped Makeup Mirror Acetate Portable Pocket Vanity Mirror With Handle Marble Tortoise Pattern Aesthetic
-5%
$1.64
No MOQ
 · 
86 sold recently
Portable Toothbrush Case Travel Toiletry Organizer Plastic Polka Dot Black Cat Pattern With Metal Handle
Portable Toothbrush Case Travel Toiletry Organizer Plastic Polka Dot Black Cat Pattern With Metal Handle
like
Find Similar
Portable travel toothbrush case with polka dot pattern and cute cartoon cat motif - Creamy White Polka Dot Cat
Portable Toothbrush Case Travel Toiletry Organizer Plastic Polka Dot Black Cat Pattern With Metal Handle
$1.38
No MOQ
Cartoon Big Eyes Mesh Toiletry Bag PVC Waterproof Portable Travel Makeup Storage Pouch Zippered Stationery Organizer
Cartoon Big Eyes Mesh Toiletry Bag PVC Waterproof Portable Travel Makeup Storage Pouch Zippered Stationery Organizer
like
Find Similar
Cute black mesh storage bag with cartoon eyes embroidery and portable hand strap - Large / Black
Cute orange mesh makeup bag with cartoon eyes and a zipper closure handle - Small / Orange
Green mesh stationery bag with big eyes design and handle on a white background - Small / Green
Cute pink mesh stationery bag with big eyes design and handle for travel storage - Small / Pink
+4
Cartoon Big Eyes Mesh Toiletry Bag PVC Waterproof Portable Travel Makeup Storage Pouch Zippered Stationery Organizer
$1.91-2.28
No MOQ
 · 
20 sold recently
Portable Makeup Brush Storage Bag PU EVA Waterproof Travel Cosmetic Case Minimalist Zipper Pouch For Women
Portable Makeup Brush Storage Bag PU EVA Waterproof Travel Cosmetic Case Minimalist Zipper Pouch For Women
like
Find Similar
Portable makeup brush travel case with set of 12 professional cosmetic brushes - Small
Portable makeup brush set with mesh organizer bag on dark wood background - Large
Portable Makeup Brush Storage Bag PU EVA Waterproof Travel Cosmetic Case Minimalist Zipper Pouch For Women
$1.38-1.73
No MOQ
 · 
26 views
Large Capacity Portable Makeup Case PU Leather With Mirror Travel Storage Box Cute Cartoon Patterns For Women
Large Capacity Portable Makeup Case PU Leather With Mirror Travel Storage Box Cute Cartoon Patterns For Women
like
Find Similar
Cute cartoon puppy vanity case in light blue felt with large storage capacity - Cloud Star Puppy
Detail of a white PU leather makeup case featuring cute watercolor cat illustrations - Star Cat
Light blue cosmetic case featuring cute cartoon puppy print and sturdy top handle - Blue Best Friend Puppy
Cream-colored large capacity makeup bag featuring cute hand-drawn puppy and bear prints - Goodnight Bear
+19
Large Capacity Portable Makeup Case PU Leather With Mirror Travel Storage Box Cute Cartoon Patterns For Women
$5.19
No MOQ
 · 
19 views
Large Capacity Makeup Bag Waterproof Fabric Standing Toiletry Organizer Portable Travel Storage Pouch Women Simple Style
Large Capacity Makeup Bag Waterproof Fabric Standing Toiletry Organizer Portable Travel Storage Pouch Women Simple Style
like
Find Similar
Close-up of a light blue square cosmetic bag with handle and FUSHUN label on a desk - Blue
Standing beige fabric toiletry bag with handle on desk next to laptop and makeup brushes - Beige
Detail of minimalist black wash bag with Simple Life woven label in an office setting - Black
Large Capacity Makeup Bag Waterproof Fabric Standing Toiletry Organizer Portable Travel Storage Pouch Women Simple Style
$4.61
No MOQ
Vintage Floral Canvas Cosmetic Bag For Women Portable Makeup Organizer Travel Toiletry Wash Bag With Jacquard Pattern
Vintage Floral Canvas Cosmetic Bag For Women Portable Makeup Organizer Travel Toiletry Wash Bag With Jacquard Pattern
like
Find Similar
Retro floral jacquard cosmetic bag for travel featuring red and blue bloom patterns - Off White
NewVintage Floral Canvas Cosmetic Bag For Women Portable Makeup Organizer Travel Toiletry Wash Bag With Jacquard Pattern
$2.02
No MOQ
Light Luxury Fluted Plastic Makeup Organizer Box With Transparent Dustproof Lid For Cosmetic Cotton Pads Swabs Holder
Light Luxury Fluted Plastic Makeup Organizer Box With Transparent Dustproof Lid For Cosmetic Cotton Pads Swabs Holder
like
Find Similar
Pink cosmetics organizer with vertical texture and gold sphere feet, 213.5x85.7x91mm - Pink
White cotton pad storage box with vertical stripes and rose gold feet 21.3x8.5cm - White
Dark green cosmetic storage box with vertical stripes and rose gold feet - Green
Reddish brown cosmetic cotton pad organizer with gold legs and clear lid, size 213mm - Dusty Pink
Light Luxury Fluted Plastic Makeup Organizer Box With Transparent Dustproof Lid For Cosmetic Cotton Pads Swabs Holder
$3.11
No MOQ
 · 
20 sold recently
Portable Makeup Mirror Stainless Steel Unbreakable Card Size Ultra Thin With PU Leather Sleeve For Travel Purse
Portable Makeup Mirror Stainless Steel Unbreakable Card Size Ultra Thin With PU Leather Sleeve For Travel Purse
like
Find Similar
Portable cream white leather sleeve with polished stainless steel card makeup mirror - White
Portable stainless steel makeup mirror with black litchi pattern leather sleeve - Black
Portable stainless steel mirror with pink PU leather case and convenient pull tab - Rose Red
Portable stainless steel mirror with orange-brown PU leather sleeve and single card slot - Orange Red
+8
Portable Makeup Mirror Stainless Steel Unbreakable Card Size Ultra Thin With PU Leather Sleeve For Travel Purse
$0.84
Mix MOQ : 2
 · 
33 views
Fashion Women Polyester Waterproof Makeup Bag Gothic Skull Floral Print Travel Toiletry Storage Organizer Clutch Bag
Fashion Women Polyester Waterproof Makeup Bag Gothic Skull Floral Print Travel Toiletry Storage Organizer Clutch Bag
like
Find Similar
Waterproof skull and floral print makeup bag with durable zipper on white background - Skull Floral Print Style (hzb1167)
Fashion Women Polyester Waterproof Makeup Bag Gothic Skull Floral Print Travel Toiletry Storage Organizer Clutch Bag
$1.73
No MOQ
Women Cute Cartoon Alpaca Pattern Makeup Bag Polyester Travel Cosmetic Pouch Toiletry Organizer Zipper Handbag Wash Bag
Women Cute Cartoon Alpaca Pattern Makeup Bag Polyester Travel Cosmetic Pouch Toiletry Organizer Zipper Handbag Wash Bag
like
Find Similar
Detailed view of the pink alpaca makeup bag featuring durable fabric and black zipper - Pink Alpaca Print Style (hzb933)
Women Cute Cartoon Alpaca Pattern Makeup Bag Polyester Travel Cosmetic Pouch Toiletry Organizer Zipper Handbag Wash Bag
$1.73
No MOQ
Luxury Striped PET Cosmetic Storage Box With Lid And Gold Handle For Cotton Swabs Lipstick Makeup Desktop Organizer
Luxury Striped PET Cosmetic Storage Box With Lid And Gold Handle For Cotton Swabs Lipstick Makeup Desktop Organizer
like
Find Similar
Dark grey transparent acrylic makeup organizer with gold knob and vertical stripe design - Emerald Green With Lid
Transparent acrylic makeup organizer with vertical stripes and golden handle, 13.5x9x10cm - Clear White With Lid
Dual-compartment transparent makeup organizer with lid for cotton pads and swabs - Clear White
Transparent acrylic organizer box with lid and compartments for cotton pads and swabs - Emerald Green
Luxury Striped PET Cosmetic Storage Box With Lid And Gold Handle For Cotton Swabs Lipstick Makeup Desktop Organizer
$1.67-1.87
No MOQ
 · 
58 views
Quilted Polyester Makeup Bag With Bow Large Capacity Portable Toiletry Storage Zipper Pouch For Women Students Sweet Style
Quilted Polyester Makeup Bag With Bow Large Capacity Portable Toiletry Storage Zipper Pouch For Women Students Sweet Style
like
Find Similar
Detailed shot of pink quilted makeup bag with bow accents and soft diamond pattern textures - Clutch Bag / Pink
Close-up of quilted cosmetic bag with blue ribbon bows and soft fabric texture - Clutch Bag / White
Detail of blue quilted cosmetic bag featuring soft fabric and decorative bow accents - Clutch Bag / Blue
Pink quilted pouch with bow details and carry handle for makeup or stationery - Makeup Bag / Pink
+2
Quilted Polyester Makeup Bag With Bow Large Capacity Portable Toiletry Storage Zipper Pouch For Women Students Sweet Style
-4%
$2.31-3.43
No MOQ
Unicorn Rainbow Heavy Metal Print Makeup Bag Durable Polyester Travel Cosmetic Organizer Portable Storage Pouch For Women Girls
Unicorn Rainbow Heavy Metal Print Makeup Bag Durable Polyester Travel Cosmetic Organizer Portable Storage Pouch For Women Girls
like
Find Similar
Detail view of the metal zipper and colorful unicorn rainbow print on black makeup bag - Unicorn Rainbow-Black
Unicorn Rainbow Heavy Metal Print Makeup Bag Durable Polyester Travel Cosmetic Organizer Portable Storage Pouch For Women Girls
$1.73
No MOQ
Transparent Makeup Brush Storage Bag Portable Waterproof PU Leather Cosmetic Pouch With Clear Window For Travel Organization
Transparent Makeup Brush Storage Bag Portable Waterproof PU Leather Cosmetic Pouch With Clear Window For Travel Organization
like
Find Similar
Mint green portable PU makeup bag with transparent window and zipper closure - Green
Black synthetic leather makeup brush bag with large transparent PVC window and silver zipper - Black
Pink makeup brush bag with clear window and silver metal zipper puller - Pink
Portable cream-colored PU leather and transparent PVC cosmetic pencil bag for travel - Off White
+1
Transparent Makeup Brush Storage Bag Portable Waterproof PU Leather Cosmetic Pouch With Clear Window For Travel Organization
-8%
$1.59
No MOQ
Portable Makeup Brush Storage Box Plastic Transparent Rectangular Dustproof Cosmetic Organizer Case Eyebrow Pencil Holder
Portable Makeup Brush Storage Box Plastic Transparent Rectangular Dustproof Cosmetic Organizer Case Eyebrow Pencil Holder
like
Find Similar
Transparent rectangular plastic makeup brush storage box with secure clasp and flip lid - Clear
Detailed view of the pink plastic cosmetic box with a secure buckle and hanging hole - Pink
Pink translucent plastic storage box showing secure buckle design and hanging hole detail - Purple
Portable Makeup Brush Storage Box Plastic Transparent Rectangular Dustproof Cosmetic Organizer Case Eyebrow Pencil Holder
$0.36
Mix MOQ : 3
 · 
45 sold recently
Shiny Metallic Quilted Butterfly Pattern Makeup Bag Portable Travel Toiletry Organizer Zipper Cosmetic Handheld Storage Bag
Shiny Metallic Quilted Butterfly Pattern Makeup Bag Portable Travel Toiletry Organizer Zipper Cosmetic Handheld Storage Bag
like
Find Similar
Three-piece silver metallic vanity bag set with quilted butterfly patterns for travel - Large / Silver
Pink satin quilted 3-piece makeup bag set with handle and embroidered butterfly pattern - Large / Pink
Quilted PU bow cosmetic bag set with heart pouch on bed for travel storage - Large / Beige
+6
NewShiny Metallic Quilted Butterfly Pattern Makeup Bag Portable Travel Toiletry Organizer Zipper Cosmetic Handheld Storage Bag
$1.87-3.60
No MOQ
Portable Polyester Makeup Bag Digital Print Cartoon Dinosaur Pattern Travel Toiletry Organizer Zipper Pouch For Women
Portable Polyester Makeup Bag Digital Print Cartoon Dinosaur Pattern Travel Toiletry Organizer Zipper Pouch For Women
like
Find Similar
Cosmetic bag featuring digital dinosaur and palm tree print with a black zipper top - Cartoon Dinosaur Style (hzb993)
Portable Polyester Makeup Bag Digital Print Cartoon Dinosaur Pattern Travel Toiletry Organizer Zipper Pouch For Women
-5%
$1.51
No MOQ
Portable Compact Makeup Mirror Round Metal Foldable Double Sided Pocket Handheld Vanity Tool For Travel
Portable Compact Makeup Mirror Round Metal Foldable Double Sided Pocket Handheld Vanity Tool For Travel
like
Find Similar
Portable rose gold round metal makeup mirrors with smooth polished surface finish - Double Arc / Rose Gold
Portable silver metallic compact mirror with a sleek circular folding design - Double Arc / Silver
Pair of polished gold round metal folding makeup mirrors on a clean white background - Double Arc / Gold
Glossy black portable metal makeup mirror with round double-sided folding design - Double Arc / Black
+1
Portable Compact Makeup Mirror Round Metal Foldable Double Sided Pocket Handheld Vanity Tool For Travel
$1.38-1.61
Mix MOQ : 2
 · 
276 sold recently
Canvas Makeup Bag Zippered Pouch For Cosmetics Hair Accessories Electronic Chargers Travel Storage Case With Wristlet
Canvas Makeup Bag Zippered Pouch For Cosmetics Hair Accessories Electronic Chargers Travel Storage Case With Wristlet
like
Find Similar
Beige canvas organizer bag with All My Fucking Drugs print and black zipper strap - All My Fucking Drugs Slogan Style
Cream canvas hair accessory pouch with black HAIR STUFF print and wrist strap - HAIR STUFF Hair Accessories Icons
Canvas emergency snacks zipper pouch in off-white with black strap and bold lettering - EMERGENCY SNACKS Slogan Style
Off-white canvas storage bag for chargers with black wrist strap and top zipper closure - CHARGERS Electronics Accessories Icons
Canvas Makeup Bag Zippered Pouch For Cosmetics Hair Accessories Electronic Chargers Travel Storage Case With Wristlet
-4%
$1.37
No MOQ
Cosmetic Storage Box Makeup Organizer With Drawer Multi Compartment PP Plastic Skincare Jewelry Holder For Vanity
Cosmetic Storage Box Makeup Organizer With Drawer Multi Compartment PP Plastic Skincare Jewelry Holder For Vanity
like
Find Similar
Beige and light green cosmetic organizer box with drawers and compartments for vanity - Light Blue
Minimalist beige desktop makeup organizer with a light green drawer and compartments - Light Green
Beige plastic makeup organizer with a pink drawer for cosmetics and jewelry storage - Light Pink
Cosmetic Storage Box Makeup Organizer With Drawer Multi Compartment PP Plastic Skincare Jewelry Holder For Vanity
$0.47
No MOQ
 · 
29 sold recently
Halloween Makeup Bag Waterproof Polyester Zipper Toiletry Case Portable Cosmetic Organizer Ghost Pumpkin Printed Travel Storage Bag For Women
Halloween Makeup Bag Waterproof Polyester Zipper Toiletry Case Portable Cosmetic Organizer Ghost Pumpkin Printed Travel Storage Bag For Women
like
Find Similar
Waterproof Halloween cosmetic bag with cartoon ghost, pumpkin, and castle digital print - Halloween Mixed Print Style (hzb1194)
Halloween Makeup Bag Waterproof Polyester Zipper Toiletry Case Portable Cosmetic Organizer Ghost Pumpkin Printed Travel Storage Bag For Women
-5%
$1.64
No MOQ
Heart Print Drawstring Storage Bag Cream Textured Fabric Portable Makeup Pouch Travel Organizer For Toiletries Jewelry
Heart Print Drawstring Storage Bag Cream Textured Fabric Portable Makeup Pouch Travel Organizer For Toiletries Jewelry
like
Find Similar
Detail view of champagne drawstring pouch with black hearts showing cosmetics inside - Small
Detailed texture of cotton linen drawstring pouch with black heart prints and logo tag - M
Close-up of champagne heart drawstring pouch with woven logo on satin fabric - Large
Three sizes of cream drawstring bags with black heart prints and textured fabric - Small And Medium And Large
Heart Print Drawstring Storage Bag Cream Textured Fabric Portable Makeup Pouch Travel Organizer For Toiletries Jewelry
-5%
$0.53-2.06
Mix MOQ : 5
 · 
10 sold recently
Free Shipping
Western Style Digital Printed Snake Pattern Polyester Cosmetic Bag For Women Portable Travel Toiletry Makeup Storage Pouch
Western Style Digital Printed Snake Pattern Polyester Cosmetic Bag For Women Portable Travel Toiletry Makeup Storage Pouch
like
Find Similar
Detail view of durable snakeskin print makeup bag featuring black zipper and strap closure - Snake Print (hzb997)
Western Style Digital Printed Snake Pattern Polyester Cosmetic Bag For Women Portable Travel Toiletry Makeup Storage Pouch
-5%
$1.64
No MOQ
Women Hanging Toiletry Bag Travel Makeup Organizer Waterproof Large Capacity Cosmetic Bag With Hanging Hook For Travel
Women Hanging Toiletry Bag Travel Makeup Organizer Waterproof Large Capacity Cosmetic Bag With Hanging Hook For Travel
like
Find Similar
Sky blue portable hanging toiletry bag with four compartments and golden zipper details - Blue
Portable travel toiletry bag in black leather finish with hanging hook and pink interior - Black
Women Hanging Toiletry Bag Travel Makeup Organizer Waterproof Large Capacity Cosmetic Bag With Hanging Hook For Travel
$8.93
No MOQ
Compact Makeup Mirror Double Sided Folding Round Metal Handheld Pocket Mirror With Magnification For Travel Purse Vanity
Compact Makeup Mirror Double Sided Folding Round Metal Handheld Pocket Mirror With Magnification For Travel Purse Vanity
like
Find Similar
Close-up of a silver-plated circular compact makeup mirror showing dual-sided glass and metal latch - Silver
Portable round folding makeup mirror in polished gold metal with a double-sided design - Gold
Portable round folding metal makeup mirror in polished rose gold finish with dual mirrors - Rose Gold
Compact Makeup Mirror Double Sided Folding Round Metal Handheld Pocket Mirror With Magnification For Travel Purse Vanity
$1.73
Mix MOQ : 2
 · 
16 sold recently
Big Eyes Cartoon Mesh Tote Bag Portable PVC Nylon Breathable Travel Beach Swimming Toiletry Organizer
Big Eyes Cartoon Mesh Tote Bag Portable PVC Nylon Breathable Travel Beach Swimming Toiletry Organizer
like
Find Similar
Pink mesh beach tote bag featuring cartoon big eyes design with white woven handles - Pink
Orange mesh beach tote bag featuring large eye design and beige fabric handles - Orange Red
Green mesh beach bag with large cartoon eyes and beige handles for travel and swimming - Green
Black mesh beach tote bag featuring white crescent logo and durable carry handles - Black
Big Eyes Cartoon Mesh Tote Bag Portable PVC Nylon Breathable Travel Beach Swimming Toiletry Organizer
$3.40
No MOQ
Handmade Acetate Flower Shaped Mini Pocket Makeup Mirror Vintage Sunflower Portable Small Round Mirror For Travel Women Girls
Handmade Acetate Flower Shaped Mini Pocket Makeup Mirror Vintage Sunflower Portable Small Round Mirror For Travel Women Girls
like
Find Similar
Detail view of pink acetate floral portable makeup mirror on minimalist desk setup - Pink
Portable floral mini pocket mirror with vintage colorful acetate petal frame design - Colorful
Close-up of pearl white floral acetate mini makeup mirror on a minimalist background - Mermaid Iridescent
Handmade Acetate Flower Shaped Mini Pocket Makeup Mirror Vintage Sunflower Portable Small Round Mirror For Travel Women Girls
$2.88
No MOQ
 · 
18 views
Large Capacity Dual Layer Makeup Bag Cationic Oxford Cloth Waterproof Toiletry Organizer Handheld Travel Storage Pouch
Large Capacity Dual Layer Makeup Bag Cationic Oxford Cloth Waterproof Toiletry Organizer Handheld Travel Storage Pouch
like
Find Similar
Gray double-layer travel toiletry bag with waterproof texture and wide top handle - Gray
Dark blue double-layer travel toiletry bag with waterproof fabric and carry handle - Navy Blue
Black double-layer cationic travel toiletry bag with white plane logo and handle - Black
Beige double-layer cationic toiletry bag with travel print and sturdy top handle - Beige
+1
Large Capacity Dual Layer Makeup Bag Cationic Oxford Cloth Waterproof Toiletry Organizer Handheld Travel Storage Pouch
-5%
$3.23
No MOQ
Quilted Floral Cosmetic Bag Ruffle Edge Bowknot Makeup Pouch Portable Toiletry Organizer Kawaii Pencil Case For Women Girls
Quilted Floral Cosmetic Bag Ruffle Edge Bowknot Makeup Pouch Portable Toiletry Organizer Kawaii Pencil Case For Women Girls
like
Find Similar
Close-up of quilted floral makeup bag with pink bow pattern and elegant lace trim detail - White
Detail of pink quilted floral cosmetic bag with lace trim and ribbon handle - Pink
Quilted Floral Cosmetic Bag Ruffle Edge Bowknot Makeup Pouch Portable Toiletry Organizer Kawaii Pencil Case For Women Girls
$2.45
Mix MOQ : 2
 · 
68 views
Canvas Makeup Bag Portable Contrast Color Travel Toiletry Pouch Minimalist Zipper Organizer For Cosmetics Handheld
Canvas Makeup Bag Portable Contrast Color Travel Toiletry Pouch Minimalist Zipper Organizer For Cosmetics Handheld
like
Find Similar
Pink canvas makeup bag with yellow zipper and side handle for travel storage - Pink(With Yellow Zipper)
Detail of blue canvas makeup bag with pink zipper handle and Utoo brand label - Blue(With Pink Zipper)
Minimalist cream canvas toiletry bag with vibrant red zipper and handle for travel - Cream(With Red Zipper)
Close-up of candy color canvas makeup bag with purple zipper and top handle detail - Yellow(With Purple Zipper)
Canvas Makeup Bag Portable Contrast Color Travel Toiletry Pouch Minimalist Zipper Organizer For Cosmetics Handheld
-5%
$2.46
No MOQ
Panda Print Makeup Bag Women Multi-functional Travel Toiletry Storage Pouch Polyester Zipper Cosmetic Organizer Bag
Panda Print Makeup Bag Women Multi-functional Travel Toiletry Storage Pouch Polyester Zipper Cosmetic Organizer Bag
like
Find Similar
Detail of water resistant panda print cosmetic bag with secure black zipper and wrist strap - Panda Print (hzb942)
Panda Print Makeup Bag Women Multi-functional Travel Toiletry Storage Pouch Polyester Zipper Cosmetic Organizer Bag
$1.73
No MOQ
Professional Makeup Brushes And Mesh Storage Bag Portable Nylon Breathable Travel Cosmetic Pouch Beauty Tools For Women
Professional Makeup Brushes And Mesh Storage Bag Portable Nylon Breathable Travel Cosmetic Pouch Beauty Tools For Women
like
Find Similar
Detailed view of pink mesh makeup bag with brushes, featuring breathable nylon and gold accents - Pink
Black nylon mesh cosmetic bag with colorful makeup brushes visible inside - Black
Portable orange mesh makeup pouch with matching cosmetic brushes set on white background - Orange
Professional Makeup Brushes And Mesh Storage Bag Portable Nylon Breathable Travel Cosmetic Pouch Beauty Tools For Women
$1.30
Mix MOQ : 3
Floral Quilted Cotton Makeup Bag Portable Large Capacity Travel Cosmetic Organizer Pouch With Handle For Women Students
Floral Quilted Cotton Makeup Bag Portable Large Capacity Travel Cosmetic Organizer Pouch With Handle For Women Students
like
Find Similar
Detail of green floral quilted cotton makeup bag with a zipper and beige woven label - Portable Clutch Bag / Off-white Green Floral
Detail of light blue quilted makeup bag with small red flowers and woven label - Portable Clutch Bag / Light Blue Red Flower
Floral quilted cotton makeup bag in dark green star pattern with secure zipper handle - Large Cosmetic Bag / Off-white Green Floral
Detail of quilted cotton floral cosmetic bag hanging on a hook with woven strap - Mini Wristlet Bag / Off-white Green Floral
Floral Quilted Cotton Makeup Bag Portable Large Capacity Travel Cosmetic Organizer Pouch With Handle For Women Students
-5%
$2.05-3.43
No MOQ
 · 
17 views
Houndstooth Jacquard Makeup Bag Large Capacity Travel Toiletry Pouch Zipper Portable Cosmetic Storage Organizer Women
Houndstooth Jacquard Makeup Bag Large Capacity Travel Toiletry Pouch Zipper Portable Cosmetic Storage Organizer Women
like
Find Similar
Detailed close-up of houndstooth makeup bag containing brushes and perfume on white background - Black and White Houndstooth
Houndstooth Jacquard Makeup Bag Large Capacity Travel Toiletry Pouch Zipper Portable Cosmetic Storage Organizer Women
-11%
$2.51
No MOQ
Hanging Toiletry Bag Waterproof Cationic Oxford Cloth Travel Cosmetic Organizer For Makeup Toiletries Dry Wet Separation
Hanging Toiletry Bag Waterproof Cationic Oxford Cloth Travel Cosmetic Organizer For Makeup Toiletries Dry Wet Separation
like
Find Similar
Gray waterproof cationic travel wash bag with multiple zipper layers and top handle - Gray
Hanging Toiletry Bag Waterproof Cationic Oxford Cloth Travel Cosmetic Organizer For Makeup Toiletries Dry Wet Separation
-5%
$5.80
No MOQ
Dolphin Ocean Print Makeup Bag Fine Linen Zippered Pouch With Wrist Strap Portable Travel Cosmetic Case Stationery Bag
Dolphin Ocean Print Makeup Bag Fine Linen Zippered Pouch With Wrist Strap Portable Travel Cosmetic Case Stationery Bag
like
Find Similar
Zippered ocean animal print makeup bag featuring dolphins and tropical fish patterns - 17*25cm (Linen) with Strap / Ocean Dolphin Pattern Style (Style 1)
Dolphin Ocean Print Makeup Bag Fine Linen Zippered Pouch With Wrist Strap Portable Travel Cosmetic Case Stationery Bag
$1.44
No MOQ
Geometric Triangle Pattern Cosmetic Makeup Bag Waterproof PU Leather Portable Travel Pouch Zip Closure Organizer Women
Geometric Triangle Pattern Cosmetic Makeup Bag Waterproof PU Leather Portable Travel Pouch Zip Closure Organizer Women
like
Find Similar
Mini black quilted travel cosmetic bag showing capacity for lipstick and compact powder - Leather Black
Mini light blue PU leather cosmetic bag with geometric lines and black zipper detail - Leather Blue
Portable mini makeup bag in dark green quilted fabric showing interior storage space - Leather Green
Geometric Triangle Pattern Cosmetic Makeup Bag Waterproof PU Leather Portable Travel Pouch Zip Closure Organizer Women
-5%
$1.45
No MOQ
 · 
32 views
Christmas Cosmetic Bag Large Capacity Polyester Letter Printed Pouch For Women Festive Holiday Gift Storage Bag Wash Bag
Christmas Cosmetic Bag Large Capacity Polyester Letter Printed Pouch For Women Festive Holiday Gift Storage Bag Wash Bag
like
Find Similar
Large Christmas gift bag with letter A design and festive Santa hat detail for holiday storage - Christmas Hat Letter A Style
Christmas gift pouch featuring red canvas with green trim and letter B design - Christmas Hat Letter B Style
Christmas canvas cosmetic bag featuring a red body with green trim and letter C design - Christmas Hat Letter C Style
Christmas gift makeup bag in red and green with festive letter D and santa hat design - Christmas Hat Letter D Style
+22
Christmas Cosmetic Bag Large Capacity Polyester Letter Printed Pouch For Women Festive Holiday Gift Storage Bag Wash Bag
-4%
$0.96
Mix MOQ : 2
Plush Makeup Bag Cloud Quilted Pattern Large Capacity Portable Toiletry Storage Pouch For Women Girls
Plush Makeup Bag Cloud Quilted Pattern Large Capacity Portable Toiletry Storage Pouch For Women Girls
like
Find Similar
Detailed view of pink plush cosmetic bag with soft cloud texture and metal zipper - Pink
Detailed close-up of light blue quilted cloud makeup bag with a pink zipper contrast - Light Blue
Detail of cream plush makeup bag with diamond quilt pattern and silver glitter accents - Off White
Plush Makeup Bag Cloud Quilted Pattern Large Capacity Portable Toiletry Storage Pouch For Women Girls
-5%
$1.86
Mix MOQ : 2
 · 
38 views
Cute Cat Ear Makeup Bag Floral Jacquard Embroidery Lace Portable Cosmetic Pouch Travel Toiletries Storage Organizer Case Kawaii
Cute Cat Ear Makeup Bag Floral Jacquard Embroidery Lace Portable Cosmetic Pouch Travel Toiletries Storage Organizer Case Kawaii
like
Find Similar
Sweet white cat shaped makeup bag with floral jacquard texture and 3D cat ears - Cat Breed Bag / White
Cute light blue cat makeup bag with floral embroidery and ears, size 17x12x8cm - Cat Breed Bag / Blue
Floral mint green cat ear cosmetic bag with ribbon bow and compact 17x12x8cm size - Cat Breed Bag / Green
White cloud-shaped cosmetic bag with floral embroidery, size 18.5x14x7cm, 33.5g - Cloud Bag / White
+5
Cute Cat Ear Makeup Bag Floral Jacquard Embroidery Lace Portable Cosmetic Pouch Travel Toiletries Storage Organizer Case Kawaii
$2.54-3.31
Mix MOQ : 2
 · 
22 views
Free Shipping
Makeup Organizer Box Plastic Large Capacity Multi Compartment Drawer Style Desktop Cosmetic Storage For Vanity Skincare
Makeup Organizer Box Plastic Large Capacity Multi Compartment Drawer Style Desktop Cosmetic Storage For Vanity Skincare
like
Find Similar
Three-tier cream white makeup organizer with rotating top and storage drawers - Large Capacity Drawer Type - Creamy White
Creamy white rotating makeup organizer with gold feet and partitioned storage compartments - 360° Rotating Tray - Creamy White
Rotating moonlight white and gold cosmetic organizer with 28.5cm diameter and partitions - 360° Rotating Tray - Moonlight White
Rotating emerald green makeup organizer with gold feet and lipstick compartments - 360° Rotating Tray - Luxury Green
Makeup Organizer Box Plastic Large Capacity Multi Compartment Drawer Style Desktop Cosmetic Storage For Vanity Skincare
$6.28-10.09
No MOQ
 · 
33 views
Portable Makeup Brush Organizer Bag Roll Up Foldable Waterproof Nylon Travel Cosmetic Tools Storage Pouch
Portable Makeup Brush Organizer Bag Roll Up Foldable Waterproof Nylon Travel Cosmetic Tools Storage Pouch
like
Find Similar
Portable 12-20 slots folding makeup brush roll up organizer bag in navy blue nylon - Navy Blue
Portable Makeup Brush Organizer Bag Roll Up Foldable Waterproof Nylon Travel Cosmetic Tools Storage Pouch
$4.90
No MOQ
Large Capacity PU Leather Makeup Bag Vertical Stripe Waterproof Portable Travel Cosmetic Toiletry Organizer Pouch Women Pillow Shape Gold Zipper
Large Capacity PU Leather Makeup Bag Vertical Stripe Waterproof Portable Travel Cosmetic Toiletry Organizer Pouch Women Pillow Shape Gold Zipper
like
Find Similar
Vertical striped cream makeup bag with large capacity and multi-compartment interior - Gray
Cream-colored vertical ribbed makeup bag with large capacity and organized compartments - Beige
Pink vertical striped makeup bag with large capacity and elegant gold lettering - Pink
Caramel large capacity vertical striped makeup bag with multiple compartments and gold zipper - Brown
+1
Large Capacity PU Leather Makeup Bag Vertical Stripe Waterproof Portable Travel Cosmetic Toiletry Organizer Pouch Women Pillow Shape Gold Zipper
-4%
$2.88
No MOQ
Portable Compact Makeup Mirror PU Leather Double Sided Foldable High Heel Rhinestone Decor For Travel Vanity
Portable Compact Makeup Mirror PU Leather Double Sided Foldable High Heel Rhinestone Decor For Travel Vanity
like
Find Similar
White PU leather compact mirror featuring a sparkling rhinestone high heel motif decoration - White
Portable Compact Makeup Mirror PU Leather Double Sided Foldable High Heel Rhinestone Decor For Travel Vanity
$2.00
Mix MOQ : 2
 · 
10 sold recently
Makeup Bag Tweed Plaid Pattern Cosmetic Pouch Large Capacity Handheld Travel Toiletry Case For Women Elegant French Style
Makeup Bag Tweed Plaid Pattern Cosmetic Pouch Large Capacity Handheld Travel Toiletry Case For Women Elegant French Style
like
Find Similar
Rectangle black and gold tweed makeup bag with golden zipper and wristlet strap - Black
Pink tweed makeup bag with gold thread weaving and rectangle shape in soft pink finish - Pink
Rectangular white and gold plaid tweed cosmetic bag with elegant golden zipper handle - White
Elegant red tweed rectangular makeup bag with gold zipper and handle in a flat lay setup - Red
Makeup Bag Tweed Plaid Pattern Cosmetic Pouch Large Capacity Handheld Travel Toiletry Case For Women Elegant French Style
$2.16
Mix MOQ : 2
 · 
12 sold recently
Corduroy Cosmetic Bag Portable Toiletry Wash Pouch Solid Color Makeup Organizer Handheld Storage Case For Daily Travel
Corduroy Cosmetic Bag Portable Toiletry Wash Pouch Solid Color Makeup Organizer Handheld Storage Case For Daily Travel
like
Find Similar
Detail of a creamy white corduroy makeup bag with a minimalist woven label held by hand - Creamy White
Pink corduroy makeup bag with textured finish and fabric label on a vintage typewriter - Light Pink
Minimalist red corduroy cosmetic bag with woven logo label for portable storage - Red
Corduroy Cosmetic Bag Portable Toiletry Wash Pouch Solid Color Makeup Organizer Handheld Storage Case For Daily Travel
$2.28
No MOQ
Heart Shaped Portable Makeup Mirror Foldable Double Sided HD Glass Pocket Cosmetic Mirror For Travel Gift ABS Plastic
Heart Shaped Portable Makeup Mirror Foldable Double Sided HD Glass Pocket Cosmetic Mirror For Travel Gift ABS Plastic
like
Find Similar
Pink heart-shaped folding makeup mirror with double-sided reflection in portable design - Pink
Portable heart-shaped folding double-sided makeup mirror in pastel pink and green - Green
Heart Shaped Portable Makeup Mirror Foldable Double Sided HD Glass Pocket Cosmetic Mirror For Travel Gift ABS Plastic
-5%
$0.91
No MOQ
 · 
130 sold recently
Large Capacity Lamb Wool Makeup Bag Soft Sherpa Toiletry Storage Pouch For Travel Daily Portable Plush Cosmetic Case
Large Capacity Lamb Wool Makeup Bag Soft Sherpa Toiletry Storage Pouch For Travel Daily Portable Plush Cosmetic Case
like
Find Similar
Close-up of white plush fleece makeup bag with embroidered quote label held in hand - Off White
Large Capacity Lamb Wool Makeup Bag Soft Sherpa Toiletry Storage Pouch For Travel Daily Portable Plush Cosmetic Case
-12%
$2.86
No MOQ
Baby Powder Puff Box Plush Puff Transparent Lid ABS Case Hair Cleaning Barber Tool For Talcum Powder Application
Baby Powder Puff Box Plush Puff Transparent Lid ABS Case Hair Cleaning Barber Tool For Talcum Powder Application
like
Find Similar
Blue baby powder puff container with soft white puff in transparent packaging - Card Packaging / Blue
Pink baby powder puff box with white plush sponge and transparent lid for body care - Card Packaging / Pink
Green baby powder puff box with clear lid and soft white plush applicator tool - Card Packaging / Green
+3
Baby Powder Puff Box Plush Puff Transparent Lid ABS Case Hair Cleaning Barber Tool For Talcum Powder Application
$0.66-0.69
No MOQ
 · 
46 views
Corduroy Drawstring Storage Bag Portable Makeup Toiletry Pouch Travel Dustproof Floral Polka Dot Print Organizer
Corduroy Drawstring Storage Bag Portable Makeup Toiletry Pouch Travel Dustproof Floral Polka Dot Print Organizer
like
Find Similar
Detailed set of three floral drawstring storage bags in various sizes for travel - Small (14*16cm) / Blue Floral
Three-piece drawstring organizers in small, medium, and large with heart patterns - Medium (19*24cm) / Black with Green Heart
Detail view of a 3-piece drawstring organizer set with blue-green floral patterns - Small (14*16cm) / Emerald Green Floral
Three-piece black drawstring organizer set with white polka dots for travel storage - Large (25*32cm) / Black Polka Dots
+10
Corduroy Drawstring Storage Bag Portable Makeup Toiletry Pouch Travel Dustproof Floral Polka Dot Print Organizer
$0.48-1.06
No MOQ
Vintage Bookshelf Print Makeup Bag Fine Linen Zippered Travel Organizer Pouch With Wristlet For Women Classical
Vintage Bookshelf Print Makeup Bag Fine Linen Zippered Travel Organizer Pouch With Wristlet For Women Classical
like
Find Similar
Cosmetic bag with vintage bookshelf print, zipper closure and black wrist strap - Vintage Bookshelf Print / 17*25cm (Linen) with Strap
Vintage Bookshelf Print Makeup Bag Fine Linen Zippered Travel Organizer Pouch With Wristlet For Women Classical
$1.44
No MOQ
Round Foldable Double-Sided Makeup Mirror Cute Cartoon Bear Portable Zinc Alloy Pocket Mirror Magnifying Compact Mirror For Women Travel Gift
Round Foldable Double-Sided Makeup Mirror Cute Cartoon Bear Portable Zinc Alloy Pocket Mirror Magnifying Compact Mirror For Women Travel Gift
like
Find Similar
Portable double-sided mini folding makeup mirror with cute cartoon bear design - Pink Two Bears
Portable double-sided round makeup mirror featuring cute cartoon panda and pink flowers - Pink One Bear
Detailed macro view of the silver metal frame and cute bear illustration on the mini mirror - Blue Two Bears
Portable double-sided mini folding panda makeup mirror with silver metal shell - Blue One Bear
Round Foldable Double-Sided Makeup Mirror Cute Cartoon Bear Portable Zinc Alloy Pocket Mirror Magnifying Compact Mirror For Women Travel Gift
$0.84
No MOQ
Butterfly Shaped Folding Makeup Mirror Portable Pocket Travel Vanity Mirror Double Sided Compact Zinc Alloy PU For Women
Butterfly Shaped Folding Makeup Mirror Portable Pocket Travel Vanity Mirror Double Sided Compact Zinc Alloy PU For Women
like
Find Similar
Portable butterfly folding mirror with blue and white floral patterns and glossy finish - Blue White Pink Pattern
Cute butterfly shaped portable folding makeup mirror in vibrant blue and black pattern - Blue Black Pattern
Red and black butterfly phone grip holder with glossy finish and metal base stand - Red Black White Pattern
Portable butterfly shaped orange folding makeup mirror on a clean white background - Orange Black White Pattern
+1
Butterfly Shaped Folding Makeup Mirror Portable Pocket Travel Vanity Mirror Double Sided Compact Zinc Alloy PU For Women
$1.03
No MOQ
 · 
842 sold recently
Go to

More in home & kitchen

Explore more in travel bottles

steelstrapalloysleevewallmetaldisplayshapedesignshoulder
plasticpetkidssquarewindowcare316 stainless steeladjustablegoldcover

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access