Everful

Wholesale travel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Travel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

All products in travel bottles

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid Portable Handle For Sports Outdoor Gym Travel
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid Portable Handle For Sports Outdoor Gym Travel
like
Find Similar
Navy blue matte 1L insulated sports water bottle with gold metal straw and cleaning brush set - 1 L / 3-Piece Straw Set / Indigo Blue
1L vacuum insulated water bottle in matte yellow and pink with metal straw set - 1 L / 3-Piece Straw Set / Light Pink + Light Yellow
Blue-green gradient 1L stainless steel water bottle with golden straw and brush set - 1 L / 3-Piece Straw Set / Blue Green Gradient
Violet 1L stainless steel sports bottle with yellow lid and reusable gold straw - 1 L / 3-Piece Straw Set / Light Yellow + Purple
+39
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid Portable Handle For Sports Outdoor Gym Travel
$11.38
Mix MOQ : 2
 · 
10 sold recently
Smart Vacuum Flask 304 Stainless Steel Water Bottle With LED Temperature Display Touch Screen Leak Proof Travel Mug
Smart Vacuum Flask 304 Stainless Steel Water Bottle With LED Temperature Display Touch Screen Leak Proof Travel Mug
like
Find Similar
Smart LED temperature display thermos in brushed natural steel finish with digital sensor - 16oz / Matte Steel Color / Smart Temp Display
Sleek matte black smart vacuum thermos flask with LED temperature touch display - 16oz / Straight Cup Black / No Display
Smart LED temperature display thermos bottle in rose gold with gift set accessories - 16oz / Matte Rose Gold / Smart Temp Display
Smart LED temperature display vacuum flask in matte gold finish with sleek cylinder shape - 16oz / Matte Intelligent Gold / No Display
+19
Smart Vacuum Flask 304 Stainless Steel Water Bottle With LED Temperature Display Touch Screen Leak Proof Travel Mug
$2.29-5.45
Mix MOQ : 2
 · 
56 sold recently
Portable Contact Lens Case Kit Plastic Travel Macaron Color Storage Box Mirror Tweezers Suction Rod Solution Bottle
Portable Contact Lens Case Kit Plastic Travel Macaron Color Storage Box Mirror Tweezers Suction Rod Solution Bottle
like
Find Similar
Portable macaron color contact lens case set with mirror, tweezers and solution bottle - Multicolor
Lavender purple travel contact lens case set with L/R markings and tweezers - Purple
Pink portable contact lens case set with mirror, tweezers, and solution bottle - Pink
Minimalist bright yellow contact lens case set with mirror, tweezers, and applicator tool - Yellow
+10
Portable Contact Lens Case Kit Plastic Travel Macaron Color Storage Box Mirror Tweezers Suction Rod Solution Bottle
-4%
$0.63
No MOQ
 · 
1 reviews
Vacuum Insulated Water Bottle 304 Stainless Steel Wide Mouth Portable Handle Sports Travel Thermal Flask Floral Smile Patterns
Vacuum Insulated Water Bottle 304 Stainless Steel Wide Mouth Portable Handle Sports Travel Thermal Flask Floral Smile Patterns
like
Find Similar
650ml black stainless steel vacuum flask with pink and purple floral print and carry handle - Black Floral Style
650ml red stainless steel vacuum flask with red plaid print and carry strap lid - Red Tartan Style
Black matte 650ml wide-mouth insulated bottle with colorful floral print and handle - Black Colorful Flower
650ml wide mouth vacuum flask in cream white with yellow lid and floral pattern - Ivory Floral Yellow Lid
+94
Vacuum Insulated Water Bottle 304 Stainless Steel Wide Mouth Portable Handle Sports Travel Thermal Flask Floral Smile Patterns
-5%
$10.09
No MOQ
 · 
19 views
316 Stainless Steel Vacuum Insulated Flask Large Capacity Portable Water Bottle With Tea Infuser For Outdoor Travel Hiking
316 Stainless Steel Vacuum Insulated Flask Large Capacity Portable Water Bottle With Tea Infuser For Outdoor Travel Hiking
like
Find Similar
800ml yellow 316 stainless steel vacuum flask with tea infuser for outdoor travel - 800ML / Handle Lid + Carrying Rope / Bright Yellow
800ml silver 316 stainless steel vacuum flask with steel lid and tea filter for outdoor use - 800ML / Handle Lid + Carrying Rope / Steel Color
600ml stainless steel vacuum flask in natural steel finish with 316 inner liner - 600ml / Short Tea Filter + Carrying Rope / Steel Color
Black 600ml vacuum insulated bottle made of 316 stainless steel for outdoor travel - 600ml / Short Tea Filter + Carrying Rope / Black
+20
316 Stainless Steel Vacuum Insulated Flask Large Capacity Portable Water Bottle With Tea Infuser For Outdoor Travel Hiking
-5%
$3.01-10.54
No MOQ
 · 
24 sold recently
Vacuum Insulated Water Bottle 304 Stainless Steel Portable Loop Handle Lid Outdoor Sports Travel Matte Finish Wide Mouth
Vacuum Insulated Water Bottle 304 Stainless Steel Portable Loop Handle Lid Outdoor Sports Travel Matte Finish Wide Mouth
like
Find Similar
Close-up of purple vacuum insulated sports bottle with portable lid and matte finish - 12oz / Light Purple
Detail of pink sports water bottle with matte finish and convenient carrying loop - 12oz / Pink
Detail of black stainless steel vacuum bottle with magnetic lid and portable handle - 12oz / Black
Macro shot of white stainless steel water bottle with magnetic black lid and carrying handle - 12oz / White
+20
Vacuum Insulated Water Bottle 304 Stainless Steel Portable Loop Handle Lid Outdoor Sports Travel Matte Finish Wide Mouth
$4.90-6.58
Mix MOQ : 2
 · 
23 sold recently
Stainless Steel 304 Vacuum Insulated Water Bottle Portable Travel Flask Creative Abstract Floral Print Modern Drinkware
Stainless Steel 304 Vacuum Insulated Water Bottle Portable Travel Flask Creative Abstract Floral Print Modern Drinkware
like
Find Similar
Yellow stainless steel vacuum flask with sun and blue wave art pattern print - Yellow Sun
White stainless steel bottle with sports illustrations and dark brown matte finish cap - White Sports Theme
Pink matte stainless steel water bottle with daisy prints and motivational quote - Pink Today Daisy
Yellow matte stainless steel thermal bottle with minimalist modern leaf and arch design - Yellow Abstract Geometric
+19
Stainless Steel 304 Vacuum Insulated Water Bottle Portable Travel Flask Creative Abstract Floral Print Modern Drinkware
$9.51
No MOQ
 · 
77 views
Stainless Steel Vacuum Insulated Water Bottle With Portable Handle And Silicone Base Matte Outdoor Sports Travel Vacuum Flask
Stainless Steel Vacuum Insulated Water Bottle With Portable Handle And Silicone Base Matte Outdoor Sports Travel Vacuum Flask
like
Find Similar
Detail of orange stainless steel water bottle with portable handle and silicone boot - 500ml / Cinnabar Orange
Navy blue double-walled stainless steel insulated water bottle with integrated carry handle - 500ml / Indigo Blue
Macro detail of a light blue matte stainless steel water bottle with its silicone base cover - 500ml / Haze Blue
Lavender purple insulated stainless steel water bottle with silicone base and carry handle - 500ml / Lavender
+12
Stainless Steel Vacuum Insulated Water Bottle With Portable Handle And Silicone Base Matte Outdoor Sports Travel Vacuum Flask
$10.66
Mix MOQ : 2
 · 
65 views
Magnetic Phone Mount Insulated Water Bottle Stainless Steel Vacuum Sport Flask Portable Travel Tumbler With Handle Ring
Magnetic Phone Mount Insulated Water Bottle Stainless Steel Vacuum Sport Flask Portable Travel Tumbler With Handle Ring
like
Find Similar
Dark green matte stainless steel sport water bottle with magnetic phone mount ring - 650ml / Moss Green
Cream matte magnetic water bottle with booster ring for phone stand functionality - 650ml / Cream
Mint green magnetic insulated sports water bottle with mint booster ring phone mount - 650ml / Pale Green
Deep rose red insulated water bottle with magnetic booster ring phone holder lid - 650ml / Fuschia
+24
Magnetic Phone Mount Insulated Water Bottle Stainless Steel Vacuum Sport Flask Portable Travel Tumbler With Handle Ring
$12.39
No MOQ
 · 
39 views
Mini Vacuum Insulated Bottle Stainless Steel Wood Grain Lid Portable Thermos With Tea Infuser Matte Finish Travel Office
Mini Vacuum Insulated Bottle Stainless Steel Wood Grain Lid Portable Thermos With Tea Infuser Matte Finish Travel Office
like
Find Similar
Mini 150ml wood-grain lid vacuum flask in creamy white matte finish held in a cafe - 150ML / White
Mini 150ml and 250ml matte black vacuum insulated flasks with dark wood grain lids - 150ML / Black
Mini 250ml red vacuum insulated water bottle with wood grain lid in two sizes - 150ML / Red
Mini 150ml dark cyan vacuum insulated water bottle held in hand showing compact pocket size - 150ML / Dark Blue
+8
Mini Vacuum Insulated Bottle Stainless Steel Wood Grain Lid Portable Thermos With Tea Infuser Matte Finish Travel Office
-6%
$2.68-2.95
Mix MOQ : 2
 · 
40 views
Stainless Steel Vacuum Insulated Water Bottle Large Capacity Portable Handle Sports Flask For Outdoor Travel Office
Stainless Steel Vacuum Insulated Water Bottle Large Capacity Portable Handle Sports Flask For Outdoor Travel Office
like
Find Similar
Detail view of TYESO stainless steel insulated bottles in 530ml and 750ml sizes - 530ml / White
Comparing two TYESO matte black vacuum insulated bottles in 750ml and 530ml sizes - 530ml / Black
Detail view of 750ml and 530ml stainless steel insulated water bottles in navy blue - 530ml / Blue
Macro shot of 530ml and 750ml pink stainless steel tumblers on a wooden table - 530ml / Pink
+8
Stainless Steel Vacuum Insulated Water Bottle Large Capacity Portable Handle Sports Flask For Outdoor Travel Office
$7.46-8.08
Mix MOQ : 50
 · 
48 views
Collapsible Travel Cup Silicone Portable Folding Drinking Bottle With Lid And Carabiner For Outdoor Camping Hiking
Collapsible Travel Cup Silicone Portable Folding Drinking Bottle With Lid And Carabiner For Outdoor Camping Hiking
like
Find Similar
Collapsible silicone travel cup in mint green with metal carabiner on a white background - 180ML / Green
Collapsible light blue silicone travel cup with lid and silver carabiner clip - 180ML / Light Blue
Pink collapsible silicone travel cup with a secure lid and silver metal carabiner - 180ML / Pink
Portable white collapsible silicone travel cup with lid and silver carabiner clip - 180ML / Light Gray
Collapsible Travel Cup Silicone Portable Folding Drinking Bottle With Lid And Carabiner For Outdoor Camping Hiking
$1.21
Mix MOQ : 2
 · 
11 sold recently
Crystal Energy Water Bottle Glass Natural Quartz Healing Stone Point Wand 304 Stainless Steel Leak Proof Travel Portable
Crystal Energy Water Bottle Glass Natural Quartz Healing Stone Point Wand 304 Stainless Steel Leak Proof Travel Portable
like
Find Similar
Glass water bottle with stainless steel base and a clear hexagonal crystal pillar - Clear Quartz Bottle
Glass crystal water bottle with stainless steel lid and black fabric sleeve set - Empty Glass Bottle Without Crystal
Glass water bottle with polished black obsidian hexagonal crystal pillar and silver metal base - Obsidian Crystal Bottle
Glass water bottle with polished green hexagonal crystal wand and metallic base - Green Crystal Bottle
+12
Crystal Energy Water Bottle Glass Natural Quartz Healing Stone Point Wand 304 Stainless Steel Leak Proof Travel Portable
-4%
$4.25-13.70
No MOQ
 · 
64 views
Airplane Bottle Opener Vintage Metal Alloy Creative Bottle Opener Wedding Party Favor Travel Theme Souvenir Gift Gold
Airplane Bottle Opener Vintage Metal Alloy Creative Bottle Opener Wedding Party Favor Travel Theme Souvenir Gift Gold
like
Find Similar
Airplane shaped bottle opener in gold finish zinc alloy with propeller details - Bagged-Large Airplane-Gold
Antique bronze airplane bottle opener in a map-themed gift box for travel weddings - Boxed-Large Airplane-Gold
Airplane Bottle Opener Vintage Metal Alloy Creative Bottle Opener Wedding Party Favor Travel Theme Souvenir Gift Gold
-5%
$0.77-0.90
Mix MOQ : 2
 · 
14 sold recently
Smart Insulated Water Bottle 304 Stainless Steel LED Temperature Display Portable Vacuum Flask For Travel School Office
Smart Insulated Water Bottle 304 Stainless Steel LED Temperature Display Portable Vacuum Flask For Travel School Office
like
Find Similar
Minimalist mushroom smart vacuum flask in snowy white with 320mL capacity - 320ml Single Cup / Snowy White (No Temp Display)
Lime green 320mL mushroom insulated water bottle with portable silicone carrying strap - 320ml Single Cup / Lime Green (No Temp Display)
Peach pink 320ml smart mushroom thermos with black glossy lid and silicone handle - 320ml Single Cup / Peach Pink (No Temp Display)
Cheese yellow 320mL mini vacuum insulated water bottle with portable silicone strap - 320ml Single Cup / Cheese Yellow (No Temp Display)
+18
Smart Insulated Water Bottle 304 Stainless Steel LED Temperature Display Portable Vacuum Flask For Travel School Office
$4.90-6.05
Mix MOQ : 2
 · 
23 views
Clear Milk Box Water Bottle Square Plastic Leakproof Portable Container With Cute Cartoon Print For Travel And Picnic
Clear Milk Box Water Bottle Square Plastic Leakproof Portable Container With Cute Cartoon Print For Travel And Picnic
like
Find Similar
Handheld 500ml transparent square milk carton water bottle with fresh milk cow pattern - Black Cow 500ml
Flat lay of square milk carton water bottle with cute strawberry prints and text - Strawberry 500ml
Minimalist 500ml transparent milk carton water bottle for outdoor daily use - Transparent 500ml
Square 1000ml milk box water bottle in clear plastic with a classic screw cap design - Transparent 1000ml
+1
Clear Milk Box Water Bottle Square Plastic Leakproof Portable Container With Cute Cartoon Print For Travel And Picnic
$1.27-2.13
Mix MOQ : 2
 · 
40 sold recently
Insulated Sports 304 Stainless Steel Water Bottle With Magnetic Phone Holder Lid Vacuum Flask Portable Travel Gym Flask
Insulated Sports 304 Stainless Steel Water Bottle With Magnetic Phone Holder Lid Vacuum Flask Portable Travel Gym Flask
like
Find Similar
Cherry blossom pink stainless steel insulated water bottle with integrated MagSafe magnetic phone mount - 24oz / Magnetic Stand / Pink
Matte black stainless steel water bottle with magnetic ring handle for easy carrying - 24oz / Direct Drink / Black
Matte black stainless steel water bottle with magnetic ring lid and spare parts - 24oz / With Straw / Black
Brushed stainless steel water bottle with black magnetic ring lid for mobile phone holder - 24oz / Direct Drink / Silver
+22
Insulated Sports 304 Stainless Steel Water Bottle With Magnetic Phone Holder Lid Vacuum Flask Portable Travel Gym Flask
$6.34-6.63
No MOQ
 · 
14 sold recently
Portable Square Water Bottle Plastic Cup Leakproof With Straw Lanyard Scale Marking Minimalist Outdoor Travel
Portable Square Water Bottle Plastic Cup Leakproof With Straw Lanyard Scale Marking Minimalist Outdoor Travel
like
Find Similar
Pink and black minimalist plastic water bottle with dual-mouth design and straw - 350ml / Pink
Minimalist light blue and brown portable plastic straw water bottle with carrying strap - 350ml / Green
Sleek beige and brown portable plastic water bottle with straw and grey carry strap - 350ml / White
Minimalist deep blue portable water bottle with straw and fabric carrying strap - 350ml / Blue
Portable Square Water Bottle Plastic Cup Leakproof With Straw Lanyard Scale Marking Minimalist Outdoor Travel
$3.31
No MOQ
 · 
32 sold recently
Retro Vintage Glass Wishing Bottle Drift Bottle With Cork Stopper Alloy Pendant Mini Travel Theme Home Desktop Decor Gift
Retro Vintage Glass Wishing Bottle Drift Bottle With Cork Stopper Alloy Pendant Mini Travel Theme Home Desktop Decor Gift
like
Find Similar
Set of 12 vintage glass wish bottles with bronze charms in a kraft paper gift box - Vintage Eiffel Tower
Twelve Zodiac glass wishing bottle gift set with cork stoppers and colorful decor - Love Confession
Set of 12 mini glass wishing bottles with colorful sequins and cork stoppers in a yellow gift box - Romantic Rose
Set of 12 mini glass wish bottles with colorful sand and LOVE wooden tags in a gift box - Speak Now
+2
Retro Vintage Glass Wishing Bottle Drift Bottle With Cork Stopper Alloy Pendant Mini Travel Theme Home Desktop Decor Gift
$1.82
No MOQ
 · 
39 views
Foldable Silicone Water Bottle Collapsible Leakproof Portable Outdoor Sports Travel Cup BPA Free Lightweight Flexible
Foldable Silicone Water Bottle Collapsible Leakproof Portable Outdoor Sports Travel Cup BPA Free Lightweight Flexible
like
Find Similar
Collapsible blue 600ml silicone sports water bottle in both expanded and folded states - Blue
Collapsible 600ml light blue silicone sports bottle shown expanded and folded - Gray
+4
Foldable Silicone Water Bottle Collapsible Leakproof Portable Outdoor Sports Travel Cup BPA Free Lightweight Flexible
$2.16-4.32
Mix MOQ : 2
 · 
59 views
Aluminum Alloy Carabiners D-Shape Gourd Spring Link Hooks For Backpack Water Bottle Keyring Outdoor Travel Durable Accessory
Aluminum Alloy Carabiners D-Shape Gourd Spring Link Hooks For Backpack Water Bottle Keyring Outdoor Travel Durable Accessory
like
Find Similar
Black D-ring carabiner 4.7cm x 2.5cm with 4mm thickness for outdoor backpack use - D-shape - Black / 4.7cm x 2.5cm
Detail of black D-shaped carabiner with dimensions 4.7cm length and 4mm thickness - Gourd-shape - Black / 4.7cm x 2.3cm
Aluminum Alloy Carabiners D-Shape Gourd Spring Link Hooks For Backpack Water Bottle Keyring Outdoor Travel Durable Accessory
$0.10
Mix MOQ : 2
 · 
1K+ sold recently
Frosted Sports Water Bottle Leakproof One Key Open Portable Kettle For Fitness Outdoor Travel Plastic Drinkware With Strap
Frosted Sports Water Bottle Leakproof One Key Open Portable Kettle For Fitness Outdoor Travel Plastic Drinkware With Strap
like
Find Similar
Frosted black CASNO sports water bottle with secure locking lid and carry strap - 400ml Grey
Deep brown matte frosted sports water bottle with secure lock lid and carrying strap - 400ml Wine Red
Deep grey frosted sports water bottle with black carrying strap and pop-up lid - 560ml Grey
Frosted blue sports water bottle with leak-proof locking lid and carry strap - 560ml Blue
+17
Frosted Sports Water Bottle Leakproof One Key Open Portable Kettle For Fitness Outdoor Travel Plastic Drinkware With Strap
$2.45-4.84
No MOQ
 · 
26 views
Luxury Peacock Rhinestone Insulated Bottle 304 Stainless Steel Vacuum Flask Portable Travel Thermal Cup Gift For Women
Luxury Peacock Rhinestone Insulated Bottle 304 Stainless Steel Vacuum Flask Portable Travel Thermal Cup Gift For Women
like
Find Similar
Blue rhinestone peacock insulated bottle with silver lid held in hand by a lake - 260ml / Insulated Cup / Blue
Close-up of a luxury straw tumbler with peacock jewels and pearls held by hand outdoors - 500ml / Straw Cup / Silver
Detail of blue stainless steel cup with peacock rhinestone inlay and white faux pearls - 500ml / Straw Cup / Blue
Close-up of pink rhinestone insulated straw cup with peacock motif and pearl accents - 500ml / Straw Cup / Pink
+4
Luxury Peacock Rhinestone Insulated Bottle 304 Stainless Steel Vacuum Flask Portable Travel Thermal Cup Gift For Women
$14.41
No MOQ
 · 
49 views
Pure Titanium Insulated Water Bottle With Pop Up Straw Portable Handle Vacuum Flask For Outdoor Sports Travel
Pure Titanium Insulated Water Bottle With Pop Up Straw Portable Handle Vacuum Flask For Outdoor Sports Travel
like
Find Similar
830ml pure titanium vacuum flask with yellow accents and flip straw lid for portable use - 830ml / Lemon Yellow
830ml Pure Titanium Insulated Bottle with green lid and flip-top straw in metal finish - 830ml / Pale Green
830ml double-layer pure titanium thermos bottle with purple handle and retractable straw - 830ml / Taro Purple
Macro view of 830ml titanium insulated tumbler with pink silicone straw and handle lid - 830ml / Light Pink
+7
Pure Titanium Insulated Water Bottle With Pop Up Straw Portable Handle Vacuum Flask For Outdoor Sports Travel
$42.65
Mix MOQ : 2
 · 
27 views
Free Shipping
Stainless Steel Insulated Water Bottle Vacuum Flask With Bamboo Lid Matte Finish Portable Outdoor Travel Sports Bottle
Stainless Steel Insulated Water Bottle Vacuum Flask With Bamboo Lid Matte Finish Portable Outdoor Travel Sports Bottle
like
Find Similar
Minimalist cream-colored stainless steel thermos with natural bamboo lid and matte finish - 350ml / Cream
Minimalist 350ml lavender purple stainless steel bottle with bamboo lid and matte finish - 350ml / Taro Purple
Minimalist 350ml black matte stainless steel vacuum flask with natural bamboo lid - 350ml / Ink Black
Green matte 350ml stainless steel water bottle with natural eco-friendly bamboo lid - 350ml / Grey Green
+7
Stainless Steel Insulated Water Bottle Vacuum Flask With Bamboo Lid Matte Finish Portable Outdoor Travel Sports Bottle
$9.08
Mix MOQ : 2
 · 
44 views
Vintage World Travel Landmarks Waterproof PVC Stickers For Suitcase Laptop Guitar Water Bottle Decorative Decals
Vintage World Travel Landmarks Waterproof PVC Stickers For Suitcase Laptop Guitar Water Bottle Decorative Decals
like
Find Similar
50 vintage travel stickers featuring global landmarks for suitcases and laptops - World Landmarks
Vintage World Travel Landmarks Waterproof PVC Stickers For Suitcase Laptop Guitar Water Bottle Decorative Decals
$0.96
No MOQ
 · 
11 views
Penguin Water Bottle Double Layer Insulated Heat Resistant Glass Cup Leak Proof Lid Cute Cartoon Travel Mug Students
Penguin Water Bottle Double Layer Insulated Heat Resistant Glass Cup Leak Proof Lid Cute Cartoon Travel Mug Students
like
Find Similar
Cute penguin double-walled glass water bottle 300ml with navy blue gift box packaging - Graphite Black
Close-up of cute red penguin-shaped stainless steel vacuum water bottle held by hand - China Red
Macro view of blue penguin cartoon vacuum insulated stainless steel water bottle outdoor - Sapphire Blue
Close-up of a cute penguin-shaped vacuum flask in dark grey and white for outdoor use - Leisure Gray
Penguin Water Bottle Double Layer Insulated Heat Resistant Glass Cup Leak Proof Lid Cute Cartoon Travel Mug Students
-4%
$2.96
Mix MOQ : 2
 · 
42 views
Insulated Water Bottle 316 Stainless Steel Vacuum Flask With Spherical Lid Creative Cartoon Pattern Portable Travel Cup For Kids And Adults
Insulated Water Bottle 316 Stainless Steel Vacuum Flask With Spherical Lid Creative Cartoon Pattern Portable Travel Cup For Kids And Adults
like
Find Similar
Handheld 350ml stainless steel water bottle with red sphere lid and black stripes - 350ml / Red Spherical Lid / Red Stripes
Minimalist 350ml 316 stainless steel bottle with black vertical stripes and ball cap - 350ml / Black Spherical Lid / White Vertical Striped
Pink and white checkered 316 stainless steel water bottle with floral pattern - 350ml / Pink Spherical Lid / Pink Plaid Flower
Pink and white checkered 350ml stainless steel vacuum flask with red apple and red lid - 350ml / Red Spherical Lid / Pink White Plaid Apple
+20
Insulated Water Bottle 316 Stainless Steel Vacuum Flask With Spherical Lid Creative Cartoon Pattern Portable Travel Cup For Kids And Adults
$11.53
No MOQ
 · 
14 views
Handmade Braided Water Bottle Handle Strap With Silicone Ring For Large Tumblers Portable Outdoor Sports Travel Accessory
Handmade Braided Water Bottle Handle Strap With Silicone Ring For Large Tumblers Portable Outdoor Sports Travel Accessory
like
Find Similar
Black and white paracord handle strap for 40oz tumblers with silicone ring detail - Black
Blue and white braided rope handle strap for 40oz tumblers with 15.4-inch length - Blue
Purple and white braided rope handle for 40oz tumbler with white silicone ring - Purple
Blue and cream braided paracord water bottle handle with silicone ring for 40oz tumblers - Green
+1
Handmade Braided Water Bottle Handle Strap With Silicone Ring For Large Tumblers Portable Outdoor Sports Travel Accessory
$3.00
No MOQ
 · 
42 views
Free Shipping
Water Bottle Carrier Bag Neoprene Sleeve With Touch Screen Phone Pocket Adjustable Shoulder Strap For Outdoor Travel
Water Bottle Carrier Bag Neoprene Sleeve With Touch Screen Phone Pocket Adjustable Shoulder Strap For Outdoor Travel
like
Find Similar
Beige water bottle holder bag with adjustable strap and touchscreen phone pocket - Plastic Buckle / Off-white
Cow print water bottle pouch with clear touch screen phone pocket and carry strap - Plastic Buckle / Cow Print
Water bottle pouch with cow print, touch screen phone pocket and adjustable strap - Metal Buckle / Cow Print
Pink water bottle sleeve with touch-screen phone pocket and adjustable strap - Plastic Buckle / Pink
Water Bottle Carrier Bag Neoprene Sleeve With Touch Screen Phone Pocket Adjustable Shoulder Strap For Outdoor Travel
-5%
$4.98-5.69
No MOQ
 · 
62 views
Collapsible Coffee Cup Silicone Portable Folding Water Bottle With Leakproof Lid And Heat Insulated Sleeve For Travel Outdoor Camping
Collapsible Coffee Cup Silicone Portable Folding Water Bottle With Leakproof Lid And Heat Insulated Sleeve For Travel Outdoor Camping
like
Find Similar
Collapsible silicone travel mug in purple and white with heat-insulated grip and lid - 500ml / Purple + White
Collapsible silicone travel coffee cup in light blue and white with insulated sleeve - 350ml / Light Blue + White
Portable sage green silicone collapsible travel coffee cup with heat-resistant sleeve - 350ml / Light Green
Collapsible silicone travel cup in pink-orange with heat sleeve and secure lid - 350ml / Lotus Pink
+10
Collapsible Coffee Cup Silicone Portable Folding Water Bottle With Leakproof Lid And Heat Insulated Sleeve For Travel Outdoor Camping
-4%
$2.16-3.83
Mix MOQ : 2
 · 
70 sold recently
Vacuum Insulated Water Bottle 316 Stainless Steel Travel Flask With Portable Carry Rope Dual Use Cup Lid Leak Proof Thermos
Vacuum Insulated Water Bottle 316 Stainless Steel Travel Flask With Portable Carry Rope Dual Use Cup Lid Leak Proof Thermos
like
Find Similar
316 Stainless Steel Insulated Bottle in Matte Business Black with carrying strap - 350ml / Black
316 stainless steel vacuum insulated water bottle in literary white with brown carry strap - 350ml / White
Starry sky blue 316 stainless steel vacuum insulated water bottle with carrying rope - 350ml / Blue
Pink 316 stainless steel vacuum flask with portable carrying loop for students - 500ml / Pink
+3
Vacuum Insulated Water Bottle 316 Stainless Steel Travel Flask With Portable Carry Rope Dual Use Cup Lid Leak Proof Thermos
-4%
$5.45-6.00
Mix MOQ : 2
 · 
25 views
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Cute Cartoon Pattern Portable Lanyard School Travel Gift
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Cute Cartoon Pattern Portable Lanyard School Travel Gift
like
Find Similar
Detail of cute white thermal bottle with cat and cherry patterns and a purple handle - 600ml / White (Black Cat & Cherry Print)
Detail of insulated water bottle featuring cute puppy pattern and portable carry strap - 600ml / Blue (Plaid & Puppy Print)
Close-up of cream stainless steel bottle with bear pattern and yellow carrying strap - 600ml / Yellow (Polka Dot & Bear Print)
Detail of cute strawberry cat graphic on white stainless steel portable thermos cup - 600ml / Pink (Strawberry Cat Print)
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Cute Cartoon Pattern Portable Lanyard School Travel Gift
$5.71
No MOQ
 · 
21 views
Cute Heart Handle Vacuum Insulated Water Bottle 316 Stainless Steel Straw Mug Kawaii Bow Portable Travel Women
Cute Heart Handle Vacuum Insulated Water Bottle 316 Stainless Steel Straw Mug Kawaii Bow Portable Travel Women
like
Find Similar
Cute white stainless steel vacuum cup with blue heart handle and 3D bow detail - 500ml / Stereo Bowknot / White
Pink and black cute portable stainless steel straw cup with heart handle and bow - 500ml / Stereo Bowknot / Black
Cute light blue stainless steel thermos cup with 3D bow and yellow heart handle - 500ml / Stereo Bowknot / Light Blue
Pink insulated straw cup with heart handle and bow decoration in a handheld view - 500ml / Stereo Bowknot / Pink
+4
Cute Heart Handle Vacuum Insulated Water Bottle 316 Stainless Steel Straw Mug Kawaii Bow Portable Travel Women
$5.99
Mix MOQ : 2
 · 
45 views
Astronaut Cartoon Plastic Water Bottle Portable Strap Matte Finish Sports Drinkware Outdoor Travel Kids Students
Astronaut Cartoon Plastic Water Bottle Portable Strap Matte Finish Sports Drinkware Outdoor Travel Kids Students
like
Find Similar
Green 700ml astronaut sports water bottle with portable rope and safety lock - 700ml / Green
Close-up of 700ml space astronaut water bottle with matte finish and orange handle - 700ml / Blue
700ml brown astronaut plastic water bottle with carry strap shown in hand at a cafe - 700ml / Red
Detail of 700ml space themed astronaut water bottle with handle in a matte grey finish - 700ml / Black
Astronaut Cartoon Plastic Water Bottle Portable Strap Matte Finish Sports Drinkware Outdoor Travel Kids Students
$1.70
Mix MOQ : 2
 · 
25 views
Kawaii Cartoon Plastic Water Bottle With Straw And Filter Portable Leakproof Aesthetic Drinkware For Students Girls Office Travel
Kawaii Cartoon Plastic Water Bottle With Straw And Filter Portable Leakproof Aesthetic Drinkware For Students Girls Office Travel
like
Find Similar
Cartoon dog straw water bottle with light green lid and yellow tea infuser filter - 600ml / Green (BSQ-932)
Pink cute cartoon dog plastic cup with straw and mixer ball for girls and students - 600ml / White (BSQ-932)
Light blue and pink cartoon cat plastic straw cup for children with ENJOY LIFE print - 600ml / Purple (BSQ-932)
Pink and blue cartoon straw cup featuring a black cat design and Dream Big text - 600ml / Pink (932)
Kawaii Cartoon Plastic Water Bottle With Straw And Filter Portable Leakproof Aesthetic Drinkware For Students Girls Office Travel
$2.45
Mix MOQ : 2
 · 
35 views
Mini Insulated Water Bottle Portable Pocket Size Stainless Steel Vacuum Flask Leakproof Small Thermal Travel Cup For Outdoor
Mini Insulated Water Bottle Portable Pocket Size Stainless Steel Vacuum Flask Leakproof Small Thermal Travel Cup For Outdoor
like
Find Similar
Mini stainless steel insulated bottle in matte white finish with a minimalist design - 130ml / White
Mini stainless steel portable vacuum flask in glossy black finish for pocket carry - 130ml / Black
Mini red stainless steel vacuum flask with a sleek cylindrical design and a portable size - 130ml / Red
Mini stainless steel insulated bottle in satin gold finish, portable pocket water cup - 130ml / Gold
+1
Mini Insulated Water Bottle Portable Pocket Size Stainless Steel Vacuum Flask Leakproof Small Thermal Travel Cup For Outdoor
-4%
$2.68
Mix MOQ : 2
 · 
45 views
Portable Plastic Water Bottle With Fruit Tea Filter Strainer Scale Hidden Handle Leakproof For Outdoor Travel Students
Portable Plastic Water Bottle With Fruit Tea Filter Strainer Scale Hidden Handle Leakproof For Outdoor Travel Students
like
Find Similar
Detail of portable tea infuser bottle with built-in filter and white carrying handle - 650ml / White
Macro shot of green plastic water bottle with yellow cap and built-in tea infuser filter - 650ml / Yellow
Detail of 300ml clear plastic water bottle with pink lid, blue strap and tea infuser - 650ml / Pink
Close-up of portable plastic tea bottle with built-in filter and lemon slice inside - 650ml / Gray
Portable Plastic Water Bottle With Fruit Tea Filter Strainer Scale Hidden Handle Leakproof For Outdoor Travel Students
$2.45
No MOQ
 · 
20 views
Stainless Steel Vacuum Insulated Tumbler With Tritan Boba Straw Magnetic Handle Leak Proof Travel Water Bottle Mug
Stainless Steel Vacuum Insulated Tumbler With Tritan Boba Straw Magnetic Handle Leak Proof Travel Water Bottle Mug
like
Find Similar
Detail of 830ml tumbler featuring a 1.2cm wide Tritan straw and magnetic handle - 830ml / Milk Tea
Detail of 830ml burgundy flask with 1.2cm Tritan straw and magnetic handle - 830ml / Smoky Pink
Detail of 1.2cm wide Tritan straw and magnetic handle for 830ml insulated tumbler - 830ml / Dark Gray
Detailed view of 830ml bottle with 1.2cm wide straw and cleaning brush set - 830ml / Indigo Blue
+24
Stainless Steel Vacuum Insulated Tumbler With Tritan Boba Straw Magnetic Handle Leak Proof Travel Water Bottle Mug
$12.39
Mix MOQ : 2
Mini Vacuum Insulated Water Bottle 304 Stainless Steel Portable Thermal Flask With Tassel Wood Bead Lanyard Office Travel
Mini Vacuum Insulated Water Bottle 304 Stainless Steel Portable Thermal Flask With Tassel Wood Bead Lanyard Office Travel
like
Find Similar
Mini lavender insulated cup with U-CUP logo, beige lanyard, and decorative tassel - Tassel Light Pink-250ml
Mini mint green stainless steel insulated flask with decorative wood bead and tassel - Tassel Light Green-250ml
Mini insulated thermos bottle in creamy white with matte finish and tassel detail - Tassel Beige-250ml
Mini Morandi blue insulated water cup with wood bead tassel and non-slip striped lid - Tassel Light Grey-250ml
+4
Mini Vacuum Insulated Water Bottle 304 Stainless Steel Portable Thermal Flask With Tassel Wood Bead Lanyard Office Travel
$4.76-5.04
Mix MOQ : 2
 · 
43 sold recently
Double Wall Borosilicate Glass Tea Separation Bottle Portable Heat Resistant Travel Office Water Cup With Infuser
Double Wall Borosilicate Glass Tea Separation Bottle Portable Heat Resistant Travel Office Water Cup With Infuser
like
Find Similar
Double-walled glass tea infuser bottle with black band and strap - Standard Type / Black 350ml
Premium double-walled glass tea infuser bottle with a mint green heat insulation band - Standard Type / Green 400ml
Premium double-walled glass tea infuser bottle presented in a luxury red gift box set - Gift Box Version / Grey 350ml Gift Box
Premium double-layer glass tea infuser bottle with a creative red gift box set - Gift Box Version / Grey 400ml Gift Box
+16
Double Wall Borosilicate Glass Tea Separation Bottle Portable Heat Resistant Travel Office Water Cup With Infuser
$3.29-6.02
No MOQ
 · 
90 sold recently
316 Stainless Steel Vacuum Insulated Water Bottle Tea Infuser Portable Lanyard Frosted Surface Leakproof Travel Mug
316 Stainless Steel Vacuum Insulated Water Bottle Tea Infuser Portable Lanyard Frosted Surface Leakproof Travel Mug
like
Find Similar
Vibrant orange 350ml stainless steel insulated bottle with silver lid and hand strap - 350ml / Vibrant Orange / Standard Type
Ivory white 350ml stainless steel insulated bottle with gray woven carrying strap - 350ml / Ivory / Standard Type
Handheld 350ml stainless steel insulated bottle in matte starry black with grey lanyard - 350ml / Starry Black / Standard Type
600ml vibrant orange stainless steel insulated water bottle with handle and matte finish - 600ml / Vibrant Orange / Standard Type
+2
316 Stainless Steel Vacuum Insulated Water Bottle Tea Infuser Portable Lanyard Frosted Surface Leakproof Travel Mug
$9.22-10.09
Mix MOQ : 2
 · 
11 views
Collapsible Coffee Cup Silicone Portable Folding Travel Water Bottle With Lid And Hand Strap Lightweight Outdoor
Collapsible Coffee Cup Silicone Portable Folding Travel Water Bottle With Lid And Hand Strap Lightweight Outdoor
like
Find Similar
Portable gray silicone folding coffee cup with a black lid and carry strap on white background - Bag Packaging / Gray
Portable pink silicone folding travel cup with lid and carry strap in expanded view - Bag Packaging / Pink
Collapsible silicone coffee cup 220ml with lid and sleeve in pink and brown with box - Color Box / Pink
Collapsible Coffee Cup Silicone Portable Folding Travel Water Bottle With Lid And Hand Strap Lightweight Outdoor
$1.21-1.35
No MOQ
 · 
11 sold recently
Cute Penguin Shaped 304 Stainless Steel Insulated Water Bottle Vacuum Thermos Cup Cartoon Portable Leakproof Travel
Cute Penguin Shaped 304 Stainless Steel Insulated Water Bottle Vacuum Thermos Cup Cartoon Portable Leakproof Travel
like
Find Similar
Outdoor close-up of a creative penguin-shaped stainless steel insulated water bottle - 280ml / Black
Close-up of cute red penguin-shaped stainless steel vacuum water bottle held by hand - 280ml / Red
Macro view of blue penguin cartoon vacuum insulated stainless steel water bottle outdoor - 280ml / Blue
Close-up of a cute penguin-shaped vacuum flask in dark grey and white for outdoor use - 280ml / Gray
Cute Penguin Shaped 304 Stainless Steel Insulated Water Bottle Vacuum Thermos Cup Cartoon Portable Leakproof Travel
-4%
$5.75
Mix MOQ : 2
 · 
23 views
Silicone Collapsible Travel Cup 304 Stainless Steel Rim Portable Foldable Water Bottle For Outdoor Camping Hiking Star
Silicone Collapsible Travel Cup 304 Stainless Steel Rim Portable Foldable Water Bottle For Outdoor Camping Hiking Star
like
Find Similar
White star-shaped folding silicone travel cup in collapsed state with a gray wrist strap - Star Style (White)
Grey star-shaped collapsible silicone cup with 270ml capacity and portable lanyard - Star Style (Gray)
Orange collapsible silicone cup with star design, 270ml BPA free portable travel mug - Star Style (Orange)
Pink silicone folding cup with 270ml capacity and star design for outdoor portable use - Star Style (Pink)
+8
Silicone Collapsible Travel Cup 304 Stainless Steel Rim Portable Foldable Water Bottle For Outdoor Camping Hiking Star
-5%
$1.51
No MOQ
 · 
21 views
316 Stainless Steel Vacuum Flask Cute Cartoon Insulated Water Bottle With Straw Double Drinking Lid For School Office Travel
316 Stainless Steel Vacuum Flask Cute Cartoon Insulated Water Bottle With Straw Double Drinking Lid For School Office Travel
like
Find Similar
Blue 500ml stainless steel vacuum flask with dual-drink lid and cartoon design - Joyful Blue
500ml dual-drinking insulated bottle in misty sea blue with red cartoon bear design - Creamy White
Pink cartoon insulated bottle with dual-drink lid and 500ml capacity for students - Guava Pink
500ml vacuum insulated stainless steel water bottle in coconut milk white with stickers - Sunset White
+6
316 Stainless Steel Vacuum Flask Cute Cartoon Insulated Water Bottle With Straw Double Drinking Lid For School Office Travel
$4.47
No MOQ
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Portable Travel Cup Cute Cartoon With Ball Lid For Girls Students
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Portable Travel Cup Cute Cartoon With Ball Lid For Girls Students
like
Find Similar
Cute 400ml white thermal vacuum cup with red apple cat prints and matching gift box - 400ml / Red Apple
Cute light blue cartoon insulated 400ml vacuum cup with a puppy camping illustration - 400ml / Blue Tent
Cream yellow cartoon vacuum flask 400ml with dog print and flower handle strap - 400ml / Yellow Dog
Cute cherry pattern vacuum insulated 400ml water bottle with a pink spherical lid - 400ml / Pink Cherry
+4
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Portable Travel Cup Cute Cartoon With Ball Lid For Girls Students
$6.20
No MOQ
Vacuum Insulated Water Bottle 304 Stainless Steel Portable Travel Thermos Flask Creative Cute Ball Lid Design
Vacuum Insulated Water Bottle 304 Stainless Steel Portable Travel Thermos Flask Creative Cute Ball Lid Design
like
Find Similar
350ml minimalist stainless steel vacuum flask in ivory white and light pink spherical cap - 350ml / Pink
Close-up of a 350ml ivory white vacuum flask with a distinctive red spherical lid detail - 350ml / Red
Minimalist 350ml insulated water bottle with sky blue lid and ivory white body - 350ml / Sky Blue
Minimalist 350ml stainless steel insulated bottle in ivory white with black spherical lid - 350ml / Black
+29
Vacuum Insulated Water Bottle 304 Stainless Steel Portable Travel Thermos Flask Creative Cute Ball Lid Design
$10.09
Mix MOQ : 2
304 Stainless Steel Vacuum Insulated Water Bottle Portable Sports Flask For Outdoor Travel Matte Finish Cola Shaped Thermos
304 Stainless Steel Vacuum Insulated Water Bottle Portable Sports Flask For Outdoor Travel Matte Finish Cola Shaped Thermos
like
Find Similar
Matte black stainless steel insulated water bottle with minimalist modern design - 350ml (73x166mm) / Matte Black
Portable matte orange stainless steel water bottle with sleek cylindrical design - 350ml (73x166mm) / Pastoral Orange
Matte grey stainless steel vacuum flask with sleek minimalist design and metal accent - Moonlight Grey / 350ml (73*166 Mm) Inner 304 Outer 201
Pinkish purple matte stainless steel vacuum insulated water bottle with matching cap - 350ml (73x166mm) / Taro Purple
+113
304 Stainless Steel Vacuum Insulated Water Bottle Portable Sports Flask For Outdoor Travel Matte Finish Cola Shaped Thermos
$4.61-10.37
Mix MOQ : 3
Minimalist Borosilicate Glass Water Bottle With PU Leather Sleeve And Tea Strainer Portable Leakproof Office Travel Drinkware
Minimalist Borosilicate Glass Water Bottle With PU Leather Sleeve And Tea Strainer Portable Leakproof Office Travel Drinkware
like
Find Similar
Close-up of glass tea cup with blue-grey faux leather sleeve and carrying strap - 550ml / Blue
Close-up of glass bottle with orange leather sleeve and ONE CUP embossing - 550ml / Orange
Detail of hand holding glass tumbler with black leather sleeve and integrated tea infuser - 550ml / Black
Close-up of glass tea cup with beige leather sleeve and One Cup printed detail - 550ml / White
Minimalist Borosilicate Glass Water Bottle With PU Leather Sleeve And Tea Strainer Portable Leakproof Office Travel Drinkware
$3.17
No MOQ
 · 
14 views
Gourd Shaped Water Bottle PC Plastic Creative Chinese Style Portable Leak-Proof Outdoor Travel Sports Cup With Strap
Gourd Shaped Water Bottle PC Plastic Creative Chinese Style Portable Leak-Proof Outdoor Travel Sports Cup With Strap
like
Find Similar
Pink gradient gourd shaped plastic water bottle with black screw cap on display stand - 950ML / Pink (With Strap + Carry Rope)
Creative yellow gourd-shaped water bottle with black cap on a dark display stand - 950ML / Yellow (With Strap + Carry Rope)
Unique gourd-shaped water bottle with black gradient finish and convenient ring handle - 950ML / Black (With Strap + Carry Rope)
Translucent white gourd-shaped portable water bottle with black cap on a modern stand - 950ML / White (With Strap + Carry Rope)
+5
Gourd Shaped Water Bottle PC Plastic Creative Chinese Style Portable Leak-Proof Outdoor Travel Sports Cup With Strap
$5.79
No MOQ
Insulated Water Bottle 316 Stainless Steel Vacuum Flask With Tea Infuser Portable Strap Leakproof For Travel Office Simple
Insulated Water Bottle 316 Stainless Steel Vacuum Flask With Tea Infuser Portable Strap Leakproof For Travel Office Simple
like
Find Similar
Matte cream stainless steel vacuum flask with carry strap and hot and cold insulation - 850ml / Off White
Matte black stainless steel vacuum flask with handle and hot-cool letter print - 850ml / Black
Pink matte stainless steel vacuum insulated bottle with silicone handle and logo - 850ml / Pink
Minimalist lavender stainless steel vacuum insulated bottle with silicone handle - 850ml / Lavender
+4
Insulated Water Bottle 316 Stainless Steel Vacuum Flask With Tea Infuser Portable Strap Leakproof For Travel Office Simple
-4%
$6.28-6.55
No MOQ
 · 
11 views
Portable Straw Water Bottle Borosilicate Glass Leakproof Cartoon Animal Pattern For Kids And Students Cute Outdoor Travel Drinking Cup
Portable Straw Water Bottle Borosilicate Glass Leakproof Cartoon Animal Pattern For Kids And Students Cute Outdoor Travel Drinking Cup
like
Find Similar
Cute portable glass water cup with light blue lid and cartoon lion pattern print - 260ml / White Cat Shape
Cute puppy print glass cup with pink lid and carry strap for girls, portable design - 260ml / Blue Dog
Portable Straw Water Bottle Borosilicate Glass Leakproof Cartoon Animal Pattern For Kids And Students Cute Outdoor Travel Drinking Cup
$4.01
No MOQ
 · 
15 views
Insulated Water Bottle Stainless Steel Vacuum Flask With Portable Handle Cartoon Pattern Tea Infuser For Travel Office
Insulated Water Bottle Stainless Steel Vacuum Flask With Portable Handle Cartoon Pattern Tea Infuser For Travel Office
like
Find Similar
White 1000ml stainless steel insulated flask with cartoon design and tea infuser - 1000ml / White (With Eye Stickers)
Matte black 1000ml vacuum flask with tea infuser, carry handle and gift packaging - 1000ml / Black
Matte black 1000ml vacuum flask with tea infuser and portable handle for daily use - 1000ml / Black (With Eye Stickers)
Matte black 1000ml thermal flask with tea infuser and matching gift packaging set - 1000ml / Black (With Gift Bag)
+7
Insulated Water Bottle Stainless Steel Vacuum Flask With Portable Handle Cartoon Pattern Tea Infuser For Travel Office
$4.84-5.85
No MOQ
Portable Frosted Plastic Water Bottle Shaker Cup Leakproof With Straw And Lanyard Gradient Color Sports Travel Outdoor
Portable Frosted Plastic Water Bottle Shaker Cup Leakproof With Straw And Lanyard Gradient Color Sports Travel Outdoor
like
Find Similar
Detail of yellow gradient matte plastic bottle with dual drinking lid and carry strap - 580ml / Yellow
Close-up of hand holding blue and white gradient frosted portable cup with orange strap - 580ml / Blue
Close-up of hand holding a frosted transparent plastic tea cup with yellow SENDJUS logo - 580ml / White
Portable matte black dual-drink plastic water bottle with pink locking clip and wrist strap - 580ml / Black
+3
Portable Frosted Plastic Water Bottle Shaker Cup Leakproof With Straw And Lanyard Gradient Color Sports Travel Outdoor
$3.31-3.60
No MOQ
500ml Portable Foldable Silicone Water Bottle Leakproof Outdoor Sports Travel Kettle With Carabiner BPA Free Waist Shape
500ml Portable Foldable Silicone Water Bottle Leakproof Outdoor Sports Travel Kettle With Carabiner BPA Free Waist Shape
like
Find Similar
Collapsible silicone sports bottle in mint green with non-slip texture and carabiner clip - 500ml / Green
Beige collapsible silicone sports bottle with textured grip and metallic carabiner - 500ml / Brown
Collapsible silicone sports bottle in light blue with non-slip texture and metal carabiner - 500ml / Blue
500ml Portable Foldable Silicone Water Bottle Leakproof Outdoor Sports Travel Kettle With Carabiner BPA Free Waist Shape
$5.17
Mix MOQ : 2
Cute Plush Cup Sleeve Sherpa Fleece Portable Handbag Cartoon Cat Patch Insulated Bottle Cover Japanese Style Travel Bag
Cute Plush Cup Sleeve Sherpa Fleece Portable Handbag Cartoon Cat Patch Insulated Bottle Cover Japanese Style Travel Bag
like
Find Similar
Soft blue plush water bottle holder featuring a cute black cat embroidery and carry handle - Gray Blue
Soft purple teddy fleece drink carrier bag featuring a cute black cartoon cat patch - Light Purple
Cute beige faux sheepskin plush sleeve with a black cat embroidery for water bottles - Khaki
Creamy beige plush fleece tote bag featuring a cute cat patch for water bottles - Bright yellow
+1
Cute Plush Cup Sleeve Sherpa Fleece Portable Handbag Cartoon Cat Patch Insulated Bottle Cover Japanese Style Travel Bag
$1.99
No MOQ
Cartoon Portable Water Bottle Plastic With Straw Tea Filter Leakproof Travel Drinking Cup For Kids Girls School
Cartoon Portable Water Bottle Plastic With Straw Tea Filter Leakproof Travel Drinking Cup For Kids Girls School
like
Find Similar
Portable plastic water bottle with green cartoon lid and filter, sweet food print - 550ml / Black
Cartoon Portable Water Bottle Plastic With Straw Tea Filter Leakproof Travel Drinking Cup For Kids Girls School
$3.52
No MOQ
Cute Cow Print Plush Crossbody Bag Water Bottle Holder Mobile Phone Pouch Shoulder Purse For Women Students Travel
Cute Cow Print Plush Crossbody Bag Water Bottle Holder Mobile Phone Pouch Shoulder Purse For Women Students Travel
like
Find Similar
Detail of plush cow print water bottle bag with soft faux fur texture and shoulder strap - Big Spotted Cow
Detailed view of the soft cow pattern plush water bottle bag with a matching shoulder strap - Small Cow Print
Cute Cow Print Plush Crossbody Bag Water Bottle Holder Mobile Phone Pouch Shoulder Purse For Women Students Travel
$1.41
No MOQ
Vintage Travel Map Stickers Waterproof PVC Decals For Suitcase Laptop Water Bottle Scrapbooking Journaling DIY Retro Decor
Vintage Travel Map Stickers Waterproof PVC Decals For Suitcase Laptop Water Bottle Scrapbooking Journaling DIY Retro Decor
like
Find Similar
Vintage travel stickers set with maps and cameras for DIY luggage and laptops decoration - Best Selling Classic Style (DD223)
50 pieces of vintage world map graffiti stickers for luggage, guitars, and DIY journals - Potential New Style (YCK167)
Vintage Travel Map Stickers Waterproof PVC Decals For Suitcase Laptop Water Bottle Scrapbooking Journaling DIY Retro Decor
$0.86
No MOQ
Go to

More in home & kitchen

Explore more in travel bottles

steelstrapalloysleevewallmetaldisplayshapedesignshoulder
plasticpetkidssquarewindowcare316 stainless steeladjustablegoldcover

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access