Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

Popular collections in toe rings

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Rotatable Spinner Ring For Men Women Stainless Steel Minimalist Stress Relief Ring Cool Hip Hop Industrial Band Ring Jewelry
Rotatable Spinner Ring For Men Women Stainless Steel Minimalist Stress Relief Ring Cool Hip Hop Industrial Band Ring Jewelry
like
Find Similar
Men's two-tone rotating spinner ring in matte black and brushed silver stainless steel - US 6 / Black
Minimalist silver spinner ring for men made of polished stainless steel for stress relief - US 6 / Silver
+18
Rotatable Spinner Ring For Men Women Stainless Steel Minimalist Stress Relief Ring Cool Hip Hop Industrial Band Ring Jewelry
-5%
$0.57
No MOQ
 · 
32 sold recently
Signet Ring Stainless Steel 18K Gold Plated Minimalist Square Flat Top Mirror Polished Jewelry For Men Unisex
Signet Ring Stainless Steel 18K Gold Plated Minimalist Square Flat Top Mirror Polished Jewelry For Men Unisex
like
Find Similar
12 options
Signet Ring Stainless Steel 18K Gold Plated Minimalist Square Flat Top Mirror Polished Jewelry For Men Unisex
-5%
$1.51
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Rings
Free Shipping
S925 Sterling Silver Cute Cat Open Ring For Women Adjustable Animal Finger Ring With Zirconia Sweet Fashion Jewelry Gift
S925 Sterling Silver Cute Cat Open Ring For Women Adjustable Animal Finger Ring With Zirconia Sweet Fashion Jewelry Gift
like
Find Similar
3 options
S925 Sterling Silver Cute Cat Open Ring For Women Adjustable Animal Finger Ring With Zirconia Sweet Fashion Jewelry Gift
-10%
$14.80
No MOQ
Free Shipping
Minimalist Stainless Steel Triple Layer Hollow Out Hammered Texture Adjustable Open Ring For Women Men Cool Finger Ring Jewelry
Minimalist Stainless Steel Triple Layer Hollow Out Hammered Texture Adjustable Open Ring For Women Men Cool Finger Ring Jewelry
like
Find Similar
Top view detail of adjustable hollow triple band ring showing dimensions and texture - Silver
Rainbow stainless steel ear cuff with hammered texture and triple spiral design details - Rainbow
Detailed size view of gold 3-layer spiral open ring with diameter 1.7cm and height 1.8cm - Gold
Minimalist Stainless Steel Triple Layer Hollow Out Hammered Texture Adjustable Open Ring For Women Men Cool Finger Ring Jewelry
$0.52-0.78
Mix MOQ : 2
Hollow Heart Paw Print Open Ring Alloy Adjustable Minimalist Cute Animal Jewelry Gift For Women Girls
Hollow Heart Paw Print Open Ring Alloy Adjustable Minimalist Cute Animal Jewelry Gift For Women Girls
like
Find Similar
Silver
Gold
Hollow Heart Paw Print Open Ring Alloy Adjustable Minimalist Cute Animal Jewelry Gift For Women Girls
$0.39
Mix MOQ : 2
 · 
272 sold recently
Free Shipping
Retro Mood Ring Zinc Alloy Acrylic Temperature Sensitive Color Changing Adjustable Opening Vintage Fashion Jewelry For Women
Retro Mood Ring Zinc Alloy Acrylic Temperature Sensitive Color Changing Adjustable Opening Vintage Fashion Jewelry For Women
like
Find Similar
Vintage silver open ring featuring a pinkish-purple oval gemstone and serrated edge - 1058 Vintage Gemstone
Adjustable silver cross ring with green color-changing gemstone and multi-color options - 1028 Cross Gemstone
Adjustable vintage silver ring with heart-shaped color changing gemstone and color chart - 1039 Heart Gemstone
Adjustable silver heart ring with color-changing stone and multiple color options - 1040 Hollow Heart
+7
Retro Mood Ring Zinc Alloy Acrylic Temperature Sensitive Color Changing Adjustable Opening Vintage Fashion Jewelry For Women
$0.78
No MOQ
 · 
252 sold recently
Free Shipping
Devil Wings Arrow Open Ring For Women Men Adjustable Gothic Punk Alloy Ring Fashion Jewelry Couple Rings Gift
Devil Wings Arrow Open Ring For Women Men Adjustable Gothic Punk Alloy Ring Fashion Jewelry Couple Rings Gift
like
Find Similar
Adjustable golden arrow and devil wing open ring with a polished metallic finish - Adjustable Open / Gold
Gothic adjustable black devil wing and arrow tail open ring for couples in dark style - Adjustable Open / Gunmetal
Devil Wings Arrow Open Ring For Women Men Adjustable Gothic Punk Alloy Ring Fashion Jewelry Couple Rings Gift
$0.65
Mix MOQ : 2
Free Shipping
Vintage Viking Celtic Knot Titanium Steel Ring For Men Women Retro Braided Pattern Band Ring Fashion Ethnic Style Jewelry
Vintage Viking Celtic Knot Titanium Steel Ring For Men Women Retro Braided Pattern Band Ring Fashion Ethnic Style Jewelry
like
Find Similar
Vintage Viking Celtic knot braided texture ring in silver steel on black background - US 8
+4
Vintage Viking Celtic Knot Titanium Steel Ring For Men Women Retro Braided Pattern Band Ring Fashion Ethnic Style Jewelry
$3.14
No MOQ
 · 
10 sold recently
Free Shipping
Punk Gothic Skull Secret Compartment Ring Alloy Sliding Drawer Novelty Jewelry For Men Unisex Square Face Design
Punk Gothic Skull Secret Compartment Ring Alloy Sliding Drawer Novelty Jewelry For Men Unisex Square Face Design
like
Find Similar
Macro shot of silver punk skull ring with hidden compartment and gothic carved details - US 6 / Silver Pair
Detailed view of a gold skull ring with square face and intricate leaf carvings - US 6 / Gold Pair
Exquisite punk style skull ring set featuring a brilliant rose gold finish and detail - US 7 / Rose Gold Pair
Detailed front view of silver and gold punk skull rings with intricate 3D carvings - US 7 / Gold + Silver
+28
Punk Gothic Skull Secret Compartment Ring Alloy Sliding Drawer Novelty Jewelry For Men Unisex Square Face Design
$0.84
No MOQ
 · 
136 sold recently
Top 10% Best Sellers
in Rings
Bohemian Stainless Steel Sun Moon Open Ring For Women Gold Plated Rhinestone Celestial Adjustable Fashion Jewelry Finger Ring Gift
Bohemian Stainless Steel Sun Moon Open Ring For Women Gold Plated Rhinestone Celestial Adjustable Fashion Jewelry Finger Ring Gift
like
Find Similar
Gold stainless steel sunburst open ring with product dimensions and weight specs - Sun Style (JDR2411002)
18k gold plated stainless steel open ring with blue and white colored rhinestones - Moon Style (JDR2411001)
Bohemian Stainless Steel Sun Moon Open Ring For Women Gold Plated Rhinestone Celestial Adjustable Fashion Jewelry Finger Ring Gift
$4.32
No MOQ
 · 
16 views
Free Shipping
Western Retro Bull Head Cactus Rings Alloy Turquoise Bohemian Cowboy Style Silver Color Jewelry For Women Accessories
Western Retro Bull Head Cactus Rings Alloy Turquoise Bohemian Cowboy Style Silver Color Jewelry For Women Accessories
like
Find Similar
Detail of vintage turquoise ring set on leather with cattle engravings and cow skull motif - Antique Silver
Western Retro Bull Head Cactus Rings Alloy Turquoise Bohemian Cowboy Style Silver Color Jewelry For Women Accessories
-5%
$1.39
No MOQ
 · 
57 sold recently
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Oxidized Finish All-Seeing Eye Band Ring Fashion Jewelry Gift
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Oxidized Finish All-Seeing Eye Band Ring Fashion Jewelry Gift
like
Find Similar
7 options
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Oxidized Finish All-Seeing Eye Band Ring Fashion Jewelry Gift
$3.09
No MOQ
Free Shipping
Modern 18K Gold Plated Copper Ball Geometric Open Rings For Women Minimalist Adjustable Statement Finger Jewelry Gift
Modern 18K Gold Plated Copper Ball Geometric Open Rings For Women Minimalist Adjustable Statement Finger Jewelry Gift
like
Find Similar
Minimalist 18K gold plated multi-layer ring featuring three smooth geometric metal beads - Interwoven Ball Multi-Layer Style (14645)
Minimalist 18K gold-plated double-ring with three polished spheres on a white background - Ball Double-Ring Structure Style (14646)
Detailed view of glossy gold spiral ring with double ball design and high mirror polish - Ball Spiral Style (14751)
Modern 18K Gold Plated Copper Ball Geometric Open Rings For Women Minimalist Adjustable Statement Finger Jewelry Gift
$1.26-1.36
No MOQ
Free Shipping
Fashion Alloy Rhinestone Star Moon Open Ring For Women Adjustable Western Style Starry Moon Finger Jewelry Gold Silver Rose Gold
Fashion Alloy Rhinestone Star Moon Open Ring For Women Adjustable Western Style Starry Moon Finger Jewelry Gold Silver Rose Gold
like
Find Similar
Sparkling silver crescent moon and star open ring featuring fine zircon pave setting style - Star Moon Shape (D9114) / Silver
Close-up of gold moon and star ring with micro-pave rhinestones in a lifestyle setting - Star Moon Shape (D9113) / Gold
Rose gold crescent moon and star open ring with white rhinestones in elegant setting - Star Moon Shape (D9115) / Rose Gold
Fashion Alloy Rhinestone Star Moon Open Ring For Women Adjustable Western Style Starry Moon Finger Jewelry Gold Silver Rose Gold
-5%
$0.87
Mix MOQ : 2
 · 
11 views
Free Shipping
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
like
Find Similar
Mens silver stainless steel signet ring featuring a detailed tree of life relief on rock - US 7 / Silver
Gold stainless steel signet ring for men featuring a detailed tree of life relief design - US 7 / Gold
+12
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
$1.70-1.83
No MOQ
Free Shipping
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
like
Find Similar
5 options
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
$4.72
Mix MOQ : 2
Free Shipping
Retro Men Titanium Steel Ring Vintage Inlaid Tiger Eye Artificial Turquoise Ethnic Scrollwork Relief Punk Fashion Jewelry Ring
Retro Men Titanium Steel Ring Vintage Inlaid Tiger Eye Artificial Turquoise Ethnic Scrollwork Relief Punk Fashion Jewelry Ring
like
Find Similar
Retro punk titanium steel ring with large oval turquoise gemstone and engraved patterns - US 7 / Steel Blue Stone
Vintage punk style titanium steel ring for men featuring an oval tiger eye stone inlay - US 7 / Steel Tiger Eye
Vintage punk men's stainless steel ring with oval tiger eye stone and floral relief - US 7 / Two-tone Tiger Eye
Vintage punk silver stainless steel ring featuring a large oval turquoise with filigree - US 7 / Steel Green Stone
+24
Retro Men Titanium Steel Ring Vintage Inlaid Tiger Eye Artificial Turquoise Ethnic Scrollwork Relief Punk Fashion Jewelry Ring
-4%
$4.23-5.48
No MOQ
Free Shipping
Gothic Coffin Pentagram Ring Stainless Steel Retro Punk Men Ring Jewelry For Party Gift Black Red Enamel Ring
Gothic Coffin Pentagram Ring Stainless Steel Retro Punk Men Ring Jewelry For Party Gift Black Red Enamel Ring
like
Find Similar
Gothic men's ring with black coffin-shaped enamel and silver pentagram star detail - US 7 / Black
Retro stainless steel ring with coffin shape and pentagram star design in gothic style - US 7 / Dark Red
Retro pentagram star coffin ring in gothic stainless steel for men with red enamel finish - US 7 / Bright Red
+15
Gothic Coffin Pentagram Ring Stainless Steel Retro Punk Men Ring Jewelry For Party Gift Black Red Enamel Ring
$3.88
Mix MOQ : 5
Free Shipping
Vintage Gothic Stainless Steel Skeleton Hand Ace of Spades Poker Ring For Men Retro Punk Biker Gambling Finger Ring Jewelry
Vintage Gothic Stainless Steel Skeleton Hand Ace of Spades Poker Ring For Men Retro Punk Biker Gambling Finger Ring Jewelry
like
Find Similar
7 options
Vintage Gothic Stainless Steel Skeleton Hand Ace of Spades Poker Ring For Men Retro Punk Biker Gambling Finger Ring Jewelry
$3.09
No MOQ
 · 
22 sold recently
Free Shipping
Vintage Roman Caesar Coin Portrait Signet Ring For Men Titanium Stainless Steel Hip Hop Punk Ancient Emperor Finger Jewelry
Vintage Roman Caesar Coin Portrait Signet Ring For Men Titanium Stainless Steel Hip Hop Punk Ancient Emperor Finger Jewelry
like
Find Similar
Vintage Roman Empire Caesar coin signet ring in polished stainless steel for men - US 7 / Vintage Steel Silver
Vintage gold Roman Empire Caesar coin ring with embossed portrait and wheat patterns - US 7 / Gold
+12
Vintage Roman Caesar Coin Portrait Signet Ring For Men Titanium Stainless Steel Hip Hop Punk Ancient Emperor Finger Jewelry
$2.62-2.88
No MOQ
 · 
14 sold recently
Free Shipping
Vintage Victorian Style Enamel Ring Royal Blue Flower Rose Rhinestone Antique Gold Plated Art Nouveau Jewelry For Women
Vintage Victorian Style Enamel Ring Royal Blue Flower Rose Rhinestone Antique Gold Plated Art Nouveau Jewelry For Women
like
Find Similar
Antique Victorian style gold ring with blue enamel and sparkling diamond floral pattern - US 10 / Antique Gold Royal Blue
Vintage Victorian Style Enamel Ring Royal Blue Flower Rose Rhinestone Antique Gold Plated Art Nouveau Jewelry For Women
-4%
$1.00
No MOQ
 · 
161 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Resin Chunky Ring For Women Geometric Hexagon Rectangle Rhinestone Colorful Acrylic Inlaid Fashion Jewelry
Vintage Resin Chunky Ring For Women Geometric Hexagon Rectangle Rhinestone Colorful Acrylic Inlaid Fashion Jewelry
like
Find Similar
Macro shot of red resin ring featuring rectangular crystal and luxury pave diamond detail - Transparent Red
Macro detail of red resin hexagon ring with square gemstone and diamond accents - Rose Red
Macro view of a geometric yellow resin ring with a large rectangular crystal on silk - Transparent Yellow
Macro detail of yellow resin hexagon ring with purple gemstone on champagne satin fabric - Yellow and Light Purple
+6
Vintage Resin Chunky Ring For Women Geometric Hexagon Rectangle Rhinestone Colorful Acrylic Inlaid Fashion Jewelry
$2.62
No MOQ
 · 
14 sold recently
Free Shipping
Fashion Stainless Steel Unisex Ring With Red Artificial Opal Inlay Minimalist Individual Drip Oil Polished Band Ring Jewelry
Fashion Stainless Steel Unisex Ring With Red Artificial Opal Inlay Minimalist Individual Drip Oil Polished Band Ring Jewelry
like
Find Similar
Polished black titanium steel ring featuring an inlaid red opal finish for men - US 6 / 4MM Black
Detail view of black titanium ring featuring vibrant red crushed faux opal inlay detail - US 6 / 6MM Black
Detailed side view of black titanium ring with vibrant red synthetic opal inlay - US 6 / 8MM Black
Macro detail of titanium steel ring featuring red synthetic opal inlay and polished finish - US 6 / 8MM Silver
+28
Fashion Stainless Steel Unisex Ring With Red Artificial Opal Inlay Minimalist Individual Drip Oil Polished Band Ring Jewelry
$0.84-0.92
No MOQ
 · 
20 sold recently
Free Shipping
Vintage 925 Sterling Silver Brushed Ring For Women With Zirconia And Artificial Pearl Adjustable Minimalist Fashion Jewelry
Vintage 925 Sterling Silver Brushed Ring For Women With Zirconia And Artificial Pearl Adjustable Minimalist Fashion Jewelry
like
Find Similar
2 options
Vintage 925 Sterling Silver Brushed Ring For Women With Zirconia And Artificial Pearl Adjustable Minimalist Fashion Jewelry
$27.25
No MOQ
Free Shipping
Hip Hop Bling Full Rhinestone Stainless Steel Square Signet Ring For Men Women Gold Silver Punk Rock Jewelry Streetwear
Hip Hop Bling Full Rhinestone Stainless Steel Square Signet Ring For Men Women Gold Silver Punk Rock Jewelry Streetwear
like
Find Similar
Men's wide hip hop signet ring in gold finish with iced out micro-pave crystals - US 7 / Gold
Men's hip hop silver square ring with sparkling micro-paved rhinestones on black base - US 7 / Steel
+10
Hip Hop Bling Full Rhinestone Stainless Steel Square Signet Ring For Men Women Gold Silver Punk Rock Jewelry Streetwear
$3.93
No MOQ
Free Shipping
Minimalist Stainless Steel Open Ring For Women Men Adjustable Silver Geometric Hollow Double Layer Band Fashion Jewelry Gift
Minimalist Stainless Steel Open Ring For Women Men Adjustable Silver Geometric Hollow Double Layer Band Fashion Jewelry Gift
like
Find Similar
Detailed view of a polished silver stainless steel wide band ring with a mirror finish - Glossy Wide Plain Band (2-D-5 Laser A)
Minimalist Stainless Steel Open Ring For Women Men Adjustable Silver Geometric Hollow Double Layer Band Fashion Jewelry Gift
$0.03
No MOQ
 · 
21 views
Men's Vintage Stainless Steel All-Seeing Eye Ring Gothic Mystical Triangle Providence Signet Ring Punk Sunburst Finger Jewelry
Men's Vintage Stainless Steel All-Seeing Eye Ring Gothic Mystical Triangle Providence Signet Ring Punk Sunburst Finger Jewelry
like
Find Similar
Vintage stainless steel men's ring featuring evil eye and triangle sunburst design - US 7 / Antique Silver
Iridescent stainless steel signet ring for men with Eye of Providence and floral motifs - US 7 / Colorful
Golden stainless steel signet ring featuring embossed Evil Eye and triangle symbol - US 7 / Gold
+18
Men's Vintage Stainless Steel All-Seeing Eye Ring Gothic Mystical Triangle Providence Signet Ring Punk Sunburst Finger Jewelry
$3.14
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Turquoise Ring For Women Thin Stacking Band Japanese Korean Fresh Style Simple Jewelry Gift
Minimalist 925 Sterling Silver Turquoise Ring For Women Thin Stacking Band Japanese Korean Fresh Style Simple Jewelry Gift
like
Find Similar
Elegant S925 sterling silver stacking ring with turquoise stones for women - US Size 5 / Silver
+4
Minimalist 925 Sterling Silver Turquoise Ring For Women Thin Stacking Band Japanese Korean Fresh Style Simple Jewelry Gift
-5%
$9.73
No MOQ
 · 
20 sold recently
Free Shipping
Vintage Stainless Steel Dragon Claw Evil Eye Ring Gothic Punk Eagle Talon Open Band Ring For Men Women Fashion Jewelry Gift
Vintage Stainless Steel Dragon Claw Evil Eye Ring Gothic Punk Eagle Talon Open Band Ring For Men Women Fashion Jewelry Gift
like
Find Similar
Gothic punk dragon claw ring with blue reptile eye stone in polished stainless steel - US 7 / Coral Blue
Punk style titanium steel dragon claw ring featuring a large red oval gemstone eye - US 7 / Steel Base Red
Gothic punk dragon claw ring with purple nebula eye in stainless steel, 18mm wide band - US 7 / Purple
Gothic punk dragon claw ring with blue eye stone in vintage stainless steel finish - US 7 / Steel Base Blue
+38
Vintage Stainless Steel Dragon Claw Evil Eye Ring Gothic Punk Eagle Talon Open Band Ring For Men Women Fashion Jewelry Gift
$3.09
No MOQ
Free Shipping
Alloy Zircon Artificial Pearl Adjustable Open Rings For Women Heart Butterfly Cross Geometric Vintage Fashion Minimalist Jewelry
Alloy Zircon Artificial Pearl Adjustable Open Rings For Women Heart Butterfly Cross Geometric Vintage Fashion Minimalist Jewelry
like
Find Similar
Golden double-layer ear cuff featuring rectangular clear zircons on a satin fabric base - Gold Double Layer Irregular
Rose gold ring set featuring crisscross pave and single diamond bands on model hand - Rose Gold Triple Layer Cross
Elegant silver metal crossover rings with clear stones and minimalist solitaire design - Silver Triple Layer Cross
Double-layered gold wave open ring with pavé crystals on champagne silk background - Zigzag Double Layer
+36
Alloy Zircon Artificial Pearl Adjustable Open Rings For Women Heart Butterfly Cross Geometric Vintage Fashion Minimalist Jewelry
-5%
$1.14-2.32
No MOQ
 · 
54 sold recently
Free Shipping
Liquid Metal Irregular Wave Geometric Open Ring For Women Minimalist Adjustable Copper Silver Plated Fashion Jewelry Finger Ring
Liquid Metal Irregular Wave Geometric Open Ring For Women Minimalist Adjustable Copper Silver Plated Fashion Jewelry Finger Ring
like
Find Similar
Minimalist liquid metal wave S925 sterling silver adjustable open ring for women - Adjustable Open / Silver
Liquid Metal Irregular Wave Geometric Open Ring For Women Minimalist Adjustable Copper Silver Plated Fashion Jewelry Finger Ring
$0.60
No MOQ
Fashion Stainless Steel Rings For Women Gold Silver Zirconia Geometric Adjustable Ring Western Style Trendy Jewelry
Fashion Stainless Steel Rings For Women Gold Silver Zirconia Geometric Adjustable Ring Western Style Trendy Jewelry
like
Find Similar
Detailed specs of golden stainless steel X-cross ring showing dimensions and weight - US Size 6 / Gold Crisscross X Style (JDR2404006-6) / Gold
Detailed dimensions of gold stainless steel wrap ring with sparkling cubic zirconia stones - Adjustable / Spiral Crisscross Double Gemstone Style (JDR2405078) / Gold
Macro shot of 11g waterproof gold stainless steel spiral ring with triple-layer design - #7 / Triple Layer Spiral Thick Band Style (JDR2405003-7) / Gold
Detailed view of silver multifaceted stainless steel ring with two golden bands - US Size 8 / Combined Silver Faceted Ring Band Style (JDR2405091-PS-8) / Silver
+8
Fashion Stainless Steel Rings For Women Gold Silver Zirconia Geometric Adjustable Ring Western Style Trendy Jewelry
$4.06-5.63
No MOQ
 · 
11 views
Free Shipping
Luxury Pink Heart Bow Knot Copper Ring For Women Sparkling Inlaid Rhinestone Elegant Floral Butterfly Fashion Jewelry Romantic Adjust Open Ring
Luxury Pink Heart Bow Knot Copper Ring For Women Sparkling Inlaid Rhinestone Elegant Floral Butterfly Fashion Jewelry Romantic Adjust Open Ring
like
Find Similar
Luxury 18K silver plated ring with pink square-cut zircon and bow-knot accents - Style 0563-Wide Pink Square Gemstone (US 6)
Detailed close-up of pink and white rectangular zircon double stone ring on silver band - Style 0156-Pink Rectangular Gemstone
Detailed close-up of a luxury pink gemstone ring with star motifs and cascading stones - Style 0429-Black Square With Pink Waterfall
Macro detail of silver ring with Asscher cut pink zircon and bow on manicured hand - Style 0455-Dark Rectangular Main Stone
+26
Luxury Pink Heart Bow Knot Copper Ring For Women Sparkling Inlaid Rhinestone Elegant Floral Butterfly Fashion Jewelry Romantic Adjust Open Ring
-5%
$1.95-11.18
Mix MOQ : 2
 · 
37 sold recently
Free Shipping
Vintage Lion Head Ring For Men Stainless Steel Punk Rock Gothic Animal Biker Band Ring Hip Hop Jewelry Accessory Gift
Vintage Lion Head Ring For Men Stainless Steel Punk Rock Gothic Animal Biker Band Ring Hip Hop Jewelry Accessory Gift
like
Find Similar
Men's vintage lion head stainless steel ring with detailed 3D carving in punk style - US 7 / Steel
Men's bold lion head ring in gold finish stainless steel with black oxidized details - US 7 / Gold
+12
Vintage Lion Head Ring For Men Stainless Steel Punk Rock Gothic Animal Biker Band Ring Hip Hop Jewelry Accessory Gift
-4%
$2.74-2.99
No MOQ
 · 
11 sold recently
Free Shipping
Minimalist Star Chain Ring Stainless Steel Stackable Interlocking Star Shape Band Ring For Women Fashion Jewelry Accessory
Minimalist Star Chain Ring Stainless Steel Stackable Interlocking Star Shape Band Ring For Women Fashion Jewelry Accessory
like
Find Similar
Minimalist stackable gold star ring made of titanium steel with a polished finish and reflections - US 6 / Gold
+4
Minimalist Star Chain Ring Stainless Steel Stackable Interlocking Star Shape Band Ring For Women Fashion Jewelry Accessory
-4%
$2.82
Mix MOQ : 3
Free Shipping
Minimalist Stainless Steel Open Ring For Women Gold Plated Rhinestone Bypass Adjustable Ring Fashion Jewelry Gift
Minimalist Stainless Steel Open Ring For Women Gold Plated Rhinestone Bypass Adjustable Ring Fashion Jewelry Gift
like
Find Similar
Adjustable golden bypass ring with sparkling crystals on a minimalist open band style - US 8 / Gold (Double-sided Rhinestone)
Minimalist Stainless Steel Open Ring For Women Gold Plated Rhinestone Bypass Adjustable Ring Fashion Jewelry Gift
-4%
$2.12
No MOQ
 · 
23 sold recently
Free Shipping
Enamel Wide Band Ring Gold Plated Copper Adjustable Open Ring With Zircon Vintage Bohemian Style For Women
Enamel Wide Band Ring Gold Plated Copper Adjustable Open Ring With Zircon Vintage Bohemian Style For Women
like
Find Similar
Adjustable golden open ring with blue and white enamel leaf pattern in vintage style - Adjustable Open / Blue and White Porcelain
Adjustable gold open ring featuring colorful enamel butterflies with zircon accents - Adjustable Open / Flower Butterfly
Detailed view of adjustable wide gold ring with blue and green enamel leaf patterns - Adjustable Open / Green Porcelain
Detail of adjustable gold ring featuring abstract black and white enamel leaf texture - Adjustable Open / Black Porcelain
+4
Enamel Wide Band Ring Gold Plated Copper Adjustable Open Ring With Zircon Vintage Bohemian Style For Women
$2.09-2.44
No MOQ
 · 
207 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Gothic Stainless Steel Ring For Men Women Antique Finish Cross Floral Relief Band Ring Punk Gothic Finger Jewelry
Vintage Gothic Stainless Steel Ring For Men Women Antique Finish Cross Floral Relief Band Ring Punk Gothic Finger Jewelry
like
Find Similar
Vintage punk silver ring with embossed floral patterns and a cross antique finish - US 7 / Steel
+6
Vintage Gothic Stainless Steel Ring For Men Women Antique Finish Cross Floral Relief Band Ring Punk Gothic Finger Jewelry
$3.14
No MOQ
 · 
18 sold recently
Free Shipping
Vintage Cobra Snake Stainless Steel Ring For Men Gothic Punk Animal Scale Oxidized Silver Biker Finger Band Jewelry
Vintage Cobra Snake Stainless Steel Ring For Men Gothic Punk Animal Scale Oxidized Silver Biker Finger Band Jewelry
like
Find Similar
Retro stainless steel cobra snake ring with vintage silver finish in gothic punk style - US 7
+5
Vintage Cobra Snake Stainless Steel Ring For Men Gothic Punk Animal Scale Oxidized Silver Biker Finger Band Jewelry
$3.41
No MOQ
Free Shipping
Vintage Scorpion Titanium Steel Ring For Men Personalized Gothic Punk Antiqued Animal Statement Finger Ring Jewelry
Vintage Scorpion Titanium Steel Ring For Men Personalized Gothic Punk Antiqued Animal Statement Finger Ring Jewelry
like
Find Similar
Retro scorpion punk ring for men in vintage silver finish with oxidized steel textures - US 7 / Steel
Retro punk scorpion ring in silver gold and black stainless steel for men - US 7 / Gold & Silver
+12
Vintage Scorpion Titanium Steel Ring For Men Personalized Gothic Punk Antiqued Animal Statement Finger Ring Jewelry
$3.35-3.88
No MOQ
Free Shipping
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
like
Find Similar
Detailed view of wide gold ring featuring alternating polished and frosted textures - US 7 / Gold
Detail of silver men's ring with a frosted texture band and polished steel edges - US 7 / Silver
Detail view of black stainless steel ring with polished edges and matte meteorite texture - US 7 / Black
+15
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
-4%
$0.61-0.70
No MOQ
 · 
41 sold recently
Free Shipping
Hip Hop Fashion Titanium Steel Gold Plated Crossed Intertwined Ring For Men Women Rhinestone Pave Geometric Band Ring Jewelry
Hip Hop Fashion Titanium Steel Gold Plated Crossed Intertwined Ring For Men Women Rhinestone Pave Geometric Band Ring Jewelry
like
Find Similar
Polished gold plated titanium steel ring with three interlocking bands and pave crystals - US 7 / Gold
Detailed close-up of a silver crossover ring with polished bands and sparkling crystals - US 7 / Steel
+6
Hip Hop Fashion Titanium Steel Gold Plated Crossed Intertwined Ring For Men Women Rhinestone Pave Geometric Band Ring Jewelry
$3.01-3.27
No MOQ
 · 
14 views
Free Shipping
Vintage Stainless Steel Evil Eye Adjustable Ring Hollow Out Sunburst Pattern Open Finger Ring Jewelry For Women Men
Vintage Stainless Steel Evil Eye Adjustable Ring Hollow Out Sunburst Pattern Open Finger Ring Jewelry For Women Men
like
Find Similar
Detail shot of vintage evil eye open ring showing 1.7cm adjustable diameter size - Adjustable Open / Silver
Detail showing the adjustable opening and 1.7cm inner diameter of the evil eye ring - Adjustable Open / Rainbow
Vintage golden stainless steel evil eye open ring with 1.7cm adjustable inner diameter - Adjustable Open / Gold
Vintage Stainless Steel Evil Eye Adjustable Ring Hollow Out Sunburst Pattern Open Finger Ring Jewelry For Women Men
$0.50-0.78
Mix MOQ : 2
Free Shipping
Stainless Steel TCB Letter Hammered Texture Band Ring For Men Two-Tone Retro Rock Punk Style Fashion Finger Jewelry
Stainless Steel TCB Letter Hammered Texture Band Ring For Men Two-Tone Retro Rock Punk Style Fashion Finger Jewelry
like
Find Similar
Mens vintage stainless steel ring featuring TCB logo with textured silver and gold finish - US 7 / Two-tone (Gold & Silver)
Men's wide titanium steel ring with embossed gold letters in street fashion style - US 7 / Gold
Men's TCB engraved ring in vintage silver finish with wide stainless steel band - US 7 / Steel
+33
Stainless Steel TCB Letter Hammered Texture Band Ring For Men Two-Tone Retro Rock Punk Style Fashion Finger Jewelry
-5%
$3.48-3.73
No MOQ
Free Shipping
Eagle Signet Ring Men Alloy Gold Plated Vintage Punk Relief Carving Animal Motif Biker Hip Hop Jewelry
Eagle Signet Ring Men Alloy Gold Plated Vintage Punk Relief Carving Animal Motif Biker Hip Hop Jewelry
like
Find Similar
Vintage gold eagle ring for men with black square background and engraved relief - US 11 / AJZ2152 Vintage Eagle
Detailed close-up of a men's gold plated eagle signet ring with intricate carvings - US 12 / AJZ114 Gold
Golden men's ring with eagle relief on black inlay and sparkling zircon halo - US 9 / AJZ129 Gold (Eagle Zirconia)
Silver eagle relief ring for men with vintage engraved wings and geometric metal patterns - US 9 / AJZ114 Silver
+43
Eagle Signet Ring Men Alloy Gold Plated Vintage Punk Relief Carving Animal Motif Biker Hip Hop Jewelry
$0.47-1.36
No MOQ
 · 
604 sold recently
Free Shipping
Fashion Titanium Steel 3 Rows Rhinestone Ring For Men Women Gold Plated Wide Band Geometric Finger Ring Jewelry Gift
Fashion Titanium Steel 3 Rows Rhinestone Ring For Men Women Gold Plated Wide Band Geometric Finger Ring Jewelry Gift
like
Find Similar
Macro shot of titanium steel ring with triple rows of green crystals and gold plating - US 7 / Triple Row Green Rhinestone
Detailed macro view of gold-tone titanium ring with three rows of black crystal pavé stones - US 7 / Black
Detailed side view of golden titanium steel ring with three rows of blue crystals - US 7 / Triple Row Blue Rhinestone
Golden titanium steel ring with three rows of red crystals in a wide band design - US 7 / Triple Row Red Rhinestone
+20
Fashion Titanium Steel 3 Rows Rhinestone Ring For Men Women Gold Plated Wide Band Geometric Finger Ring Jewelry Gift
$0.60
No MOQ
 · 
24 sold recently
Free Shipping
925 Sterling Silver Open Ring Playful Cat Design With Sparkling Blue Zirconia Adjustable Animal Ring For Women Jewelry Gift
925 Sterling Silver Open Ring Playful Cat Design With Sparkling Blue Zirconia Adjustable Animal Ring For Women Jewelry Gift
like
Find Similar
3 options
925 Sterling Silver Open Ring Playful Cat Design With Sparkling Blue Zirconia Adjustable Animal Ring For Women Jewelry Gift
-14%
$13.43
Mix MOQ : 2
Free Shipping
Stainless Steel Ring OT Toggle Buckle Chain Link Design Minimalist Industrial Style Fashion Jewelry Finger Accessory
Stainless Steel Ring OT Toggle Buckle Chain Link Design Minimalist Industrial Style Fashion Jewelry Finger Accessory
like
Find Similar
Macro shot of silver OT toggle clasp and Cuban link chain detail on a modern ring - US 6 / Steel
Macro detail of golden chain link ring with industrial OT toggle closure design - US 6 / Gold
+6
Stainless Steel Ring OT Toggle Buckle Chain Link Design Minimalist Industrial Style Fashion Jewelry Finger Accessory
$2.86-3.11
No MOQ
 · 
626 sold recently
Free Shipping
Minimalist Signet Ring Stainless Steel Geometric Polished Brushed Square Rectangle Heart Cross Jewelry For Men Women
Minimalist Signet Ring Stainless Steel Geometric Polished Brushed Square Rectangle Heart Cross Jewelry For Men Women
like
Find Similar
Close-up of a silver polished stainless steel geometric ring on a dark rock surface - Steel Color (round) / Size 7
Macro view of a minimalist black stainless steel signet ring on a dark rock background - Black (circle) / Size 7
Polished gold stainless steel signet ring with a minimalist 2cm circular flat top design - Gold (round) / Size 7
Macro shot of silver polished stainless steel signet ring with a smooth mirror finish - US 6 / Large Plaid / Steel
+256
Minimalist Signet Ring Stainless Steel Geometric Polished Brushed Square Rectangle Heart Cross Jewelry For Men Women
$0.92-1.57
No MOQ
 · 
1K+ sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Gothic Bat Ring For Men Stainless Steel Retro Punk Animal Wrap Ring Halloween Party Vintage Oxidized Silver Jewelry Gift
Gothic Bat Ring For Men Stainless Steel Retro Punk Animal Wrap Ring Halloween Party Vintage Oxidized Silver Jewelry Gift
like
Find Similar
Retro bat wing gothic ring for men made of vintage silver stainless steel - US 7 / Steel
Gothic style black matte bat ring with detailed wings in punk stainless steel finish - US 7 / Black
+13
Gothic Bat Ring For Men Stainless Steel Retro Punk Animal Wrap Ring Halloween Party Vintage Oxidized Silver Jewelry Gift
$3.35-3.62
No MOQ
 · 
17 sold recently
Free Shipping
Retro Men Titanium Steel Wolf Ring Embossed Forest Starry Sky Punk Style Antique Silver Stainless Steel Band Ring Jewelry
Retro Men Titanium Steel Wolf Ring Embossed Forest Starry Sky Punk Style Antique Silver Stainless Steel Band Ring Jewelry
like
Find Similar
6 options
Retro Men Titanium Steel Wolf Ring Embossed Forest Starry Sky Punk Style Antique Silver Stainless Steel Band Ring Jewelry
$3.35
No MOQ
 · 
17 sold recently
Free Shipping
Vintage Stainless Steel Snake Ring For Women Personality Gold Rose Gold Silver Plated Polished Minimalist Animal Finger Ring Jewelry
Vintage Stainless Steel Snake Ring For Women Personality Gold Rose Gold Silver Plated Polished Minimalist Animal Finger Ring Jewelry
like
Find Similar
Detailed view of snake-shaped stainless steel ring with polished rose gold finish - US 7 / Gold
Detailed close-up of rose gold snake-shaped ring with polished mirror finish surface - US 7 / Rose Gold
+4
Vintage Stainless Steel Snake Ring For Women Personality Gold Rose Gold Silver Plated Polished Minimalist Animal Finger Ring Jewelry
$1.06
No MOQ
Free Shipping
Men Fashion Stainless Steel Ring Fishbone Pattern Punk Style Vintage Band Ring For Men Women Jewelry Accessories Gift
Men Fashion Stainless Steel Ring Fishbone Pattern Punk Style Vintage Band Ring For Men Women Jewelry Accessories Gift
like
Find Similar
Close-up of 8mm stainless steel ring featuring a silver fishbone pattern inlay - US 6 / Silver Fish Bone
Close-up of 8mm stainless steel ring with golden fishbone pattern inlay on black enamel - US 6 / Gold Fishbone
Macro detail of 8mm black stainless steel ring featuring silver fishbone pattern inlay - US 6 / Black Plated Silver Fishbone
+21
Men Fashion Stainless Steel Ring Fishbone Pattern Punk Style Vintage Band Ring For Men Women Jewelry Accessories Gift
$0.52
No MOQ
 · 
59 sold recently
Vintage Flower Cluster Rhinestone Statement Ring For Women Adjustable Open Zinc Alloy Jewelry Retro Cocktail Style
Vintage Flower Cluster Rhinestone Statement Ring For Women Adjustable Open Zinc Alloy Jewelry Retro Cocktail Style
like
Find Similar
Vintage gunmetal cocktail ring with smoky grey crystal cluster and open adjustable band - Adjustable Open / Gunmetal-Grey
Adjustable vintage silver ring featuring large cluster of faceted red crystals - Adjustable Open / Gunmetal-Red
Vintage gun-black ring with colorful floral crystal cluster and adjustable band - Adjustable Open / Gunmetal-Multicolor
Vintage flower cluster ring featuring pink and magenta crystals set in black gunmetal finish - Adjustable Open / Gun Black-Rose Red
+7
Vintage Flower Cluster Rhinestone Statement Ring For Women Adjustable Open Zinc Alloy Jewelry Retro Cocktail Style
$0.79
No MOQ
 · 
26 sold recently
Vintage Punk Gothic Skull Ring For Men Stainless Steel Two-Tone Gold Black Retro Biker Jewelry Wide Band Finger Ring Gift
Vintage Punk Gothic Skull Ring For Men Stainless Steel Two-Tone Gold Black Retro Biker Jewelry Wide Band Finger Ring Gift
like
Find Similar
Gothic punk men's black stainless steel ring featuring multi-skull wrap-around design - US Size 7 / Black
Macro shot of punk style two-tone skull ring with detailed silver and gold finish - US Size 7 / Gold & Silver
+12
Vintage Punk Gothic Skull Ring For Men Stainless Steel Two-Tone Gold Black Retro Biker Jewelry Wide Band Finger Ring Gift
$3.62
No MOQ
Free Shipping
S925 Sterling Silver Minimalist Glossy Rounded Ring For Women Retro Korean Style Niche Design Polished Band Ring Jewelry Gift
S925 Sterling Silver Minimalist Glossy Rounded Ring For Women Retro Korean Style Niche Design Polished Band Ring Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver ring set with polished finish on a white display tray - US 7# / Plain Band Ring (JZA089)
S925 Sterling Silver Minimalist Glossy Rounded Ring For Women Retro Korean Style Niche Design Polished Band Ring Jewelry Gift
-14%
$28.12-31.36
No MOQ
Free Shipping
Chunky Stainless Steel Croissant Dome Ring For Women Ribbed Textured Statement Band Gold Silver Plated Minimalist Fashion Jewelry
Chunky Stainless Steel Croissant Dome Ring For Women Ribbed Textured Statement Band Gold Silver Plated Minimalist Fashion Jewelry
like
Find Similar
Polished silver stainless steel chunky dome ring with vertical striped texture grooves - Size 6 / Steel
Polished gold dome croissant ring in chunky stainless steel with vertical textures - Size 6 / Gold
+8
Chunky Stainless Steel Croissant Dome Ring For Women Ribbed Textured Statement Band Gold Silver Plated Minimalist Fashion Jewelry
$2.62-3.14
No MOQ
 · 
14 sold recently
Free Shipping
Hawaiian Flower Engraved Alloy Ring Wide Band Tropical Leaf Plated Retro Style Jewelry For Women Anniversary Wedding Gift
Hawaiian Flower Engraved Alloy Ring Wide Band Tropical Leaf Plated Retro Style Jewelry For Women Anniversary Wedding Gift
like
Find Similar
Wide gold ring with Hawaiian floral leaf relief engraving and beaded side detailing - US 5 / Gold
Silver wide band ring with engraved rose flower patterns and 14K hallmark on inner surface - US 5 / Silver
Macro shot of rose gold ring featuring detailed flower and leaf engraving and polished interior - US 5 / Rose Gold
+18
Hawaiian Flower Engraved Alloy Ring Wide Band Tropical Leaf Plated Retro Style Jewelry For Women Anniversary Wedding Gift
$0.47
No MOQ
 · 
114 sold recently
Free Shipping
Natural Crushed Stone Wire Wrapped Open Ring Gold Metal Handmade Adjustable Crystal Gemstone Jewelry For Women Boho Style
Natural Crushed Stone Wire Wrapped Open Ring Gold Metal Handmade Adjustable Crystal Gemstone Jewelry For Women Boho Style
like
Find Similar
Handmade wire wrapped gold ring featuring a polished oval black stone in adjustable style - Black (Obsidian)
Handmade gold wire-wrapped ring with natural turquoise stone and adjustable open band - Turquoise
Handmade gold wire-wrapped open ring with a natural clear quartz crystal stone - White (Clear Quartz)
Handmade gold wire-wrapped open ring featuring an irregular natural green crystal stone - Green (Aventurine)
+2
Natural Crushed Stone Wire Wrapped Open Ring Gold Metal Handmade Adjustable Crystal Gemstone Jewelry For Women Boho Style
-5%
$1.12
Mix MOQ : 2
 · 
199 sold recently
Free Shipping
Gothic Spider Cobweb Ring Set Alloy Black Rhinestone Adjustable Open Rings Retro Punk Y2K Style Jewelry
Gothic Spider Cobweb Ring Set Alloy Black Rhinestone Adjustable Open Rings Retro Punk Y2K Style Jewelry
like
Find Similar
Detailed shot of dark gothic spider ring with heart-shaped black gemstone on hand - Large Spider Ring
Gothic spider ring with black teardrop gemstone in polished silver finish on model - Small Spider Ring
Detailed close-up of dark gothic spider web ring with a central black gemstone inlay - Spider Web Ring
Gothic silver spider rings set with black heart gemstones on a mirror surface - Spider Ring 3-Piece Set
Gothic Spider Cobweb Ring Set Alloy Black Rhinestone Adjustable Open Rings Retro Punk Y2K Style Jewelry
$0.22-0.67
No MOQ
 · 
252 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access