Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage Horse Head Titanium Steel Ring For Men Punk Gothic Distressed Biker Ring Personality Jewelry Animal Sculptural Ring
Vintage Horse Head Titanium Steel Ring For Men Punk Gothic Distressed Biker Ring Personality Jewelry Animal Sculptural Ring
like
Find Similar
6 options
Vintage Horse Head Titanium Steel Ring For Men Punk Gothic Distressed Biker Ring Personality Jewelry Animal Sculptural Ring
$3.67
No MOQ
Free Shipping
Gothic Spider Ring Zinc Alloy Faux Artificial Pearl Adjustable Open Dark Punk Style Animal Jewelry For Women Men
Gothic Spider Ring Zinc Alloy Faux Artificial Pearl Adjustable Open Dark Punk Style Animal Jewelry For Women Men
like
Find Similar
Gothic black spider adjustable open ring with iridescent dark pearl for women - Black Spider / Black
Detailed view of punk spider ring with moonstone worn by a model on black fabric - White Spider / Silver
Gothic Spider Ring Zinc Alloy Faux Artificial Pearl Adjustable Open Dark Punk Style Animal Jewelry For Women Men
$0.34
No MOQ
 · 
619 sold recently
Top 10% Best Sellers
in Rings
Luxury Copper Gold Plated Open Heart Cross Rings For Women Hip Hop Minimalist Heart Shaped Adjustable Finger Ring Rhinestone Inlaid Jewelry
Luxury Copper Gold Plated Open Heart Cross Rings For Women Hip Hop Minimalist Heart Shaped Adjustable Finger Ring Rhinestone Inlaid Jewelry
like
Find Similar
18K gold plated cross ring with micro-paved zircons and adjustable open band design - Adjustable Open / Cross Style (14725)
Luxury Copper Gold Plated Open Heart Cross Rings For Women Hip Hop Minimalist Heart Shaped Adjustable Finger Ring Rhinestone Inlaid Jewelry
-4%
$4.11
No MOQ
Free Shipping
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
like
Find Similar
Iced out gold plated dollar sign hip hop ring for men with micro paved zircons - US 7 / Gold
+6
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
$3.41
No MOQ
 · 
10 sold recently
Free Shipping
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Rock Texture Biker Finger Ring Jewelry Antique Finish Gift
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Rock Texture Biker Finger Ring Jewelry Antique Finish Gift
like
Find Similar
Macro detail of gothic demon eye ring with yellow stone and dragon scale texture - US Size 7 / Yellow
Macro shot of gothic stainless steel ring with red dragon eye gemstone and scale texture - US Size 7 / Red
+12
NewVintage Stainless Steel Evil Eye Ring For Men Gothic Punk Rock Texture Biker Finger Ring Jewelry Antique Finish Gift
$3.88
No MOQ
Free Shipping
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
like
Find Similar
Detail of gold titanium ring with square black gemstone and side groove textures - US 7 / Gold Tone Black Rhinestone
Men's titanium steel ring with a large red square gemstone and gold finish - US 7 / Gold with Red Rhinestones
Detail of square-cut blue gemstone and golden grooved band on men's titanium ring - US 7 / Gold Dark Blue Rhinestone
Detail of gold-plated signet ring featuring a large square-cut green gemstone and grooved band - US 7 / Gold Green Zirconia
+38
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
$3.14
No MOQ
Free Shipping
S925 Sterling Silver Cubic Zirconia Couple Rings Twisted Arm Wave Design Open Adjustable Engagement Wedding Gift Jewelry
S925 Sterling Silver Cubic Zirconia Couple Rings Twisted Arm Wave Design Open Adjustable Engagement Wedding Gift Jewelry
like
Find Similar
Adjustable S925 sterling silver couple rings with wave patterns and solitaire diamonds - Adjustable Open / Men's And Women's Styles (FDJZ-365)
Minimalist S925 sterling silver open ring featuring a single sparkling round zircon - Adjustable Open / Men's Style (FDJZ-365)
Elegant S925 sterling silver ring for women with bright round cubic zirconia stone - Adjustable Open / Women's Style (FDJZ-365)
S925 Sterling Silver Cubic Zirconia Couple Rings Twisted Arm Wave Design Open Adjustable Engagement Wedding Gift Jewelry
-14%
$8.38-20.43
No MOQ
Free Shipping
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
like
Find Similar
Detailed view of 18k gold titanium steel ring featuring celestial planet motifs and rhinestones - Star Moon Planet Style (JDR0205002)
Gold stainless steel ring with pink palm tree motif and micro-set zircon stones - Palm Tree Style (JDR0205004)
Golden octagonal stainless steel ring with cactus enamel and sparkling side crystals - Desert Cactus Style (JDR0205005)
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
$5.11
No MOQ
 · 
15 views
Free Shipping
Stainless Steel Dragon Head Ring For Men Punk Gothic Rhinestone Eyes Ring Retro Viking Hip Hop Biker Jewelry
Stainless Steel Dragon Head Ring For Men Punk Gothic Rhinestone Eyes Ring Retro Viking Hip Hop Biker Jewelry
like
Find Similar
Gothic dragon head ring for men in black stainless steel with detailed scales and eyes - US 7 / Black With Black Rhinestone
Detailed golden dragon head ring for men made of durable titanium steel with black stone eyes - US 7 / Gold Black Rhinestone
Detailed view of matte black titanium dragon ring with sparkling red gemstone eyes - US 7 / Black With Red Rhinestone
Detailed close-up of golden dragon head ring featuring vibrant red zircon gemstone eyes - US 7 / Gold Red Zircon
+44
Stainless Steel Dragon Head Ring For Men Punk Gothic Rhinestone Eyes Ring Retro Viking Hip Hop Biker Jewelry
$3.11-3.40
No MOQ
 · 
24 sold recently
Free Shipping
925 Sterling Silver Open Ring For Women Minimalist Adjustable Geometric Three Spheres Design INS Light Luxury Jewelry Gift
925 Sterling Silver Open Ring For Women Minimalist Adjustable Geometric Three Spheres Design INS Light Luxury Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver open ring with three graduated polished silver beads - Size 13 (Adjustable) / Silver
925 Sterling Silver Open Ring For Women Minimalist Adjustable Geometric Three Spheres Design INS Light Luxury Jewelry Gift
-14%
$16.68
No MOQ
Free Shipping
Gothic Punk Skull Ring For Men Vintage Titanium Steel Biker Skeleton Finger Ring Retro Hip Hop Rock Party Jewelry
Gothic Punk Skull Ring For Men Vintage Titanium Steel Biker Skeleton Finger Ring Retro Hip Hop Rock Party Jewelry
like
Find Similar
9 options
Gothic Punk Skull Ring For Men Vintage Titanium Steel Biker Skeleton Finger Ring Retro Hip Hop Rock Party Jewelry
-4%
$3.24
No MOQ
Free Shipping
Stainless Steel Hollow Witch Knot Open Ring For Women Men Celtic Knot Adjustable Geometric Band Ring Electroplated Jewelry
Stainless Steel Hollow Witch Knot Open Ring For Women Men Celtic Knot Adjustable Geometric Band Ring Electroplated Jewelry
like
Find Similar
Macro detail of golden Celtic knot stainless steel ring inside a premium jewelry gift box - Gold
Detailed macro view of silver Celtic knot stainless steel ring in a blue jewelry box - Silver
Detail of black stainless steel Celtic knot ring displayed in a blue velvet gift box - Black
Stainless Steel Hollow Witch Knot Open Ring For Women Men Celtic Knot Adjustable Geometric Band Ring Electroplated Jewelry
$0.52-0.60
No MOQ
Minimalist Titanium Steel Geometric Faceted Band Ring For Men Women Polished Stainless Steel Plain Couple Rings Jewelry Accessory
Minimalist Titanium Steel Geometric Faceted Band Ring For Men Women Polished Stainless Steel Plain Couple Rings Jewelry Accessory
like
Find Similar
Polished stainless steel minimalist ring for men and women with silver mirror finish - US 7 / Silver
Polished gold stainless steel ring featuring a modern minimalist geometric faceted design - US 7 / Gold
Minimalist dark grey titanium steel ring with smooth polished finish for men and women - US 7 / Black
+15
Minimalist Titanium Steel Geometric Faceted Band Ring For Men Women Polished Stainless Steel Plain Couple Rings Jewelry Accessory
-4%
$1.62-1.74
No MOQ
 · 
14 sold recently
Free Shipping
Minimalist Stainless Steel Adjustable Ring Geometric Twisted Rope Design DIY Stone Tray Ring Base For Women Men Jewelry
Minimalist Stainless Steel Adjustable Ring Geometric Twisted Rope Design DIY Stone Tray Ring Base For Women Men Jewelry
like
Find Similar
Detailed size specifications for triple setting stainless steel twisted open ring base - Silver
Detail view of rainbow plating 304 stainless steel ring with twisted texture and open band - Rainbow
Detailed view of adjustable gold-plated stainless steel ring base with three oval bezels - Gold
Minimalist Stainless Steel Adjustable Ring Geometric Twisted Rope Design DIY Stone Tray Ring Base For Women Men Jewelry
$0.52-0.78
Mix MOQ : 2
Free Shipping
Titanium Steel Eternity Ring For Women Baguette Cut Rhinestone Band Gold Silver Plated Colorful Stone Minimalist Pinky Ring Jewelry
Titanium Steel Eternity Ring For Women Baguette Cut Rhinestone Band Gold Silver Plated Colorful Stone Minimalist Pinky Ring Jewelry
like
Find Similar
Macro detail of 18K gold-plated band ring with emerald-cut red crystal stones - US 12 / Gold (Red Zirconia)
Macro view of gold minimalist ring featuring channel-set baguette-cut sparkling crystals - US 12 / Gold [White Zirconia]
Minimalist 18K gold plated titanium steel ring with baguette-cut blue zircon stones - US 12 / Gold (Blue Zirconia)
Minimalist 18K gold plated ring with channel set rectangular green crystals for women - US 12 / Gold (Green Zirconia)
+76
Titanium Steel Eternity Ring For Women Baguette Cut Rhinestone Band Gold Silver Plated Colorful Stone Minimalist Pinky Ring Jewelry
$1.70-1.96
No MOQ
 · 
11 sold recently
Free Shipping
Minimalist Stainless Steel Geometric Open Ring High Polish Metal Spheres Gold Silver Plated Unisex Adjustable Fashion Ring Jewelry
Minimalist Stainless Steel Geometric Open Ring High Polish Metal Spheres Gold Silver Plated Unisex Adjustable Fashion Ring Jewelry
like
Find Similar
Adjustable gold stainless steel ring with three polished spheres in a minimalist style - Triple Sphere Gold Open Ring (JZ21164)
18K gold plated stainless steel open ring featuring dual polished beads design - Double Sphere Gold Open Ring (JZ21165G)
Minimalist silver stainless steel ring featuring two polished 9.97mm metal spheres - Double Sphere Silver Open Ring (JZ21165S)
Silver stainless steel multi-layered open ring with polished metal spheres for women - Spiral Four Sphere Silver Open Ring (JZ21458S)
+1
Minimalist Stainless Steel Geometric Open Ring High Polish Metal Spheres Gold Silver Plated Unisex Adjustable Fashion Ring Jewelry
$1.78-3.09
No MOQ
Free Shipping
Geometric Irregular Open Rings Alloy Gold Silver Electroplated Chunky Wave Design Fashion Fingers Decoration For Women Jewelry Party Daily Accessory
Geometric Irregular Open Rings Alloy Gold Silver Electroplated Chunky Wave Design Fashion Fingers Decoration For Women Jewelry Party Daily Accessory
like
Find Similar
Gold plated geometric open ring and ear cuff set in diverse layered fashion styles - Multi-Style Combination Gold (05915)
Set of five silver minimalist liquid metal rings with polished mirror finish on beige - Multi-Style Combination Silver (05915)
Irregular wide wave ring in polished gold finish with a textured statement design - Chunky Irregular Wave Gold (00897)
Geometric Irregular Open Rings Alloy Gold Silver Electroplated Chunky Wave Design Fashion Fingers Decoration For Women Jewelry Party Daily Accessory
-5%
$0.95-1.44
Mix MOQ : 3
Vintage Punk Gothic Rings Collection For Men Ancient Silver Skull Snake Dragon Cross Eye Rhinestone Turquoise Hip Hop Jewelry
Vintage Punk Gothic Rings Collection For Men Ancient Silver Skull Snake Dragon Cross Eye Rhinestone Turquoise Hip Hop Jewelry
like
Find Similar
Close-up of vintage punk rings featuring skull, dragon and snake motifs in retro silver finish - Vintage Punk Style (06963) / Antique Silver
Vintage Punk Gothic Rings Collection For Men Ancient Silver Skull Snake Dragon Cross Eye Rhinestone Turquoise Hip Hop Jewelry
$4.43
No MOQ
 · 
22 sold recently
Minimalist Stainless Steel Open Ring For Women Hypoallergenic Irregular Waterdrop Cross Adjustable Finger Ring Jewelry Gift
Minimalist Stainless Steel Open Ring For Women Hypoallergenic Irregular Waterdrop Cross Adjustable Finger Ring Jewelry Gift
like
Find Similar
Silver stainless steel waterproof wrap ring with teardrop ends and hypoallergenic finish - Waterdrop Wrap Style (JZ21518S)
Irregular fluid silver stainless steel ring with polished mirror finish and liquid texture - Irregular Fluid Cross Style (JZ21520S)
Minimalist Stainless Steel Open Ring For Women Hypoallergenic Irregular Waterdrop Cross Adjustable Finger Ring Jewelry Gift
$3.01
No MOQ
Free Shipping
Exquisite Zinc Alloy Butterfly Knot Opening Adjustable Ring For Women Silver Rhinestone Inlaid Fashion Finger Jewelry
Exquisite Zinc Alloy Butterfly Knot Opening Adjustable Ring For Women Silver Rhinestone Inlaid Fashion Finger Jewelry
like
Find Similar
Exquisite silver butterfly ring with sparkling zircon stones in a minimalist open design - Butterfly Knot Open Style (XHJZ009) / Silver
Exquisite Zinc Alloy Butterfly Knot Opening Adjustable Ring For Women Silver Rhinestone Inlaid Fashion Finger Jewelry
$0.24
No MOQ
 · 
15 sold recently
Stainless Steel Open Adjustable Leaf Butterfly Star Moon Gold Rings Elegant Minimalist Nature Themed Jewelry Gift For Women
Stainless Steel Open Adjustable Leaf Butterfly Star Moon Gold Rings Elegant Minimalist Nature Themed Jewelry Gift For Women
like
Find Similar
Gold ginkgo leaf stainless steel adjustable open ring featuring infinity design - Ginkgo Leaf Style (JDR0210006)
Golden ginkgo leaf open ring in waterproof stainless steel with textured leaf veins - Realistic Large Leaf Style (JDR0210007)
Detail view of 18K gold plated stainless steel star and moon ring with sizing specifications - Star Moon Style (JDR0203008)
Stainless Steel Open Adjustable Leaf Butterfly Star Moon Gold Rings Elegant Minimalist Nature Themed Jewelry Gift For Women
$2.23-2.36
No MOQ
Free Shipping
Vintage Punk Skull Ring Number 13 Shield Signet Ring For Men Titanium Steel Biker Rock Gothic Jewelry Gold Silver Bicolor
Vintage Punk Skull Ring Number 13 Shield Signet Ring For Men Titanium Steel Biker Rock Gothic Jewelry Gold Silver Bicolor
like
Find Similar
Punk style stainless steel hexagon ring with golden number 13 and skull details - US 7 / Two-tone (Gold & Silver)
Close-up of stainless steel biker ring featuring a number 13 on hexagonal face and skull sides - US 7 / Steel
+14
Vintage Punk Skull Ring Number 13 Shield Signet Ring For Men Titanium Steel Biker Rock Gothic Jewelry Gold Silver Bicolor
-4%
$2.71-2.96
No MOQ
 · 
14 sold recently
Free Shipping
925 Sterling Silver Irregular Fluid Open Ring Adjustable Minimalist Liquid Metal Style Jewelry For Women Fashion Index Finger Ring
925 Sterling Silver Irregular Fluid Open Ring Adjustable Minimalist Liquid Metal Style Jewelry For Women Fashion Index Finger Ring
like
Find Similar
Irregular liquid style S925 sterling silver open ring with polished metallic finish - Adjustable Size 14 / White Gold
Minimalist irregular S925 sterling silver ring with liquid metal gold lava texture - Adjustable Size 14 / 18K Gold
925 Sterling Silver Irregular Fluid Open Ring Adjustable Minimalist Liquid Metal Style Jewelry For Women Fashion Index Finger Ring
-15%
$36.54
Mix MOQ : 2
Free Shipping
Minimalist 304 Stainless Steel Matte Brushed Wide Band Ring For Men Women Punk Style Wedding Finger Jewelry
Minimalist 304 Stainless Steel Matte Brushed Wide Band Ring For Men Women Punk Style Wedding Finger Jewelry
like
Find Similar
Macro detail of 12mm wide gold titanium ring featuring brushed matte texture and polished inner - US 5 / Gold
Close-up of 12mm wide titanium steel ring featuring a matte brushed finish and smooth inner band - US 5 / Silver
Detailed view of 12mm wide titanium ring with black brushed finish and matte texture - US 5 / Black
12mm wide matte titanium steel band ring with vintage industrial sandblasted finish - US 7 / Distressed Antique Silver
+30
Minimalist 304 Stainless Steel Matte Brushed Wide Band Ring For Men Women Punk Style Wedding Finger Jewelry
-5%
$0.75-0.80
No MOQ
 · 
20 sold recently
Minimalist Stainless Steel Open Ring For Women Gold Plated Geometric Double Parallel Line T-Shaped Adjustable Finger Ring Fashion Jewelry
Minimalist Stainless Steel Open Ring For Women Gold Plated Geometric Double Parallel Line T-Shaped Adjustable Finger Ring Fashion Jewelry
like
Find Similar
3 options
Minimalist Stainless Steel Open Ring For Women Gold Plated Geometric Double Parallel Line T-Shaped Adjustable Finger Ring Fashion Jewelry
$2.64
Mix MOQ : 2
Free Shipping
Vintage Punk Stainless Steel Ring For Men Women Gothic Dragon Evil Eye Ring Gold Plated Embossed Texture Retro Finger Jewelry Gift
Vintage Punk Stainless Steel Ring For Men Women Gothic Dragon Evil Eye Ring Gold Plated Embossed Texture Retro Finger Jewelry Gift
like
Find Similar
Macro detail of vintage gold steel ring featuring a red and black demon eye stone - US 7 / Full Gold Red Eye
Detailed macro shot of a gold-tone dragon eye ring featuring a red stone and lava texture - US 7 / Full Gold Red Eye Style 2
Macro detail of gothic stainless steel ring featuring a yellow dragon eye focal point - US 7 / Full Gold Yellow Eye
Detailed macro shot of vintage gold punk ring featuring a striking purple evil eye stone - US 7 / Full Gold Purple Eye
+101
Vintage Punk Stainless Steel Ring For Men Women Gothic Dragon Evil Eye Ring Gold Plated Embossed Texture Retro Finger Jewelry Gift
$3.14
No MOQ
Free Shipping
Vintage Alloy Feather Evil Eye Open Ring For Men Retro Adjustable Purple Cat Eye Stone Punk Gothic Jewelry Finger Ring
Vintage Alloy Feather Evil Eye Open Ring For Men Retro Adjustable Purple Cat Eye Stone Punk Gothic Jewelry Finger Ring
like
Find Similar
Retro feather ring with purple evil eye stone, vintage alloy open design, size 28x14mm - Silver
Vintage Alloy Feather Evil Eye Open Ring For Men Retro Adjustable Purple Cat Eye Stone Punk Gothic Jewelry Finger Ring
$0.73
Mix MOQ : 2
Irregular Geometric Stainless Steel Open Ring For Women Liquid Metal Wave Punk Adjustable Gold Silver Jewelry Gift
Irregular Geometric Stainless Steel Open Ring For Women Liquid Metal Wave Punk Adjustable Gold Silver Jewelry Gift
like
Find Similar
Macro shot showing dimensions and thickness of gold irregular wavy stainless steel ring - Gold
Detail view of silver irregular lava-like lines on a waterproof stainless steel ring - Silver
Irregular Geometric Stainless Steel Open Ring For Women Liquid Metal Wave Punk Adjustable Gold Silver Jewelry Gift
$1.30-1.41
No MOQ
Free Shipping
Vintage Gothic Punk Wolf Tooth Ring For Men Titanium Steel Viking Bio-inspired Fang Distressed Antique Silver Band Ring
Vintage Gothic Punk Wolf Tooth Ring For Men Titanium Steel Viking Bio-inspired Fang Distressed Antique Silver Band Ring
like
Find Similar
Gothic punk wolf fang ring in vintage silver titanium steel for men with dark textures - US 7 / Worn Silver
+5
Vintage Gothic Punk Wolf Tooth Ring For Men Titanium Steel Viking Bio-inspired Fang Distressed Antique Silver Band Ring
$3.14
No MOQ
Free Shipping
S925 Sterling Silver Colored Zirconia Horseshoe Ring For Women Adjustable Chain Ring Fashion Delicate U-Shaped Finger Jewelry Gift
S925 Sterling Silver Colored Zirconia Horseshoe Ring For Women Adjustable Chain Ring Fashion Delicate U-Shaped Finger Jewelry Gift
like
Find Similar
1 option
S925 Sterling Silver Colored Zirconia Horseshoe Ring For Women Adjustable Chain Ring Fashion Delicate U-Shaped Finger Jewelry Gift
-14%
$8.41
No MOQ
Free Shipping
Gothic Punk Armor Nail Rings For Women Men Adjustable Open Alloy Cross Sword Starburst Aesthetic Jewelry Retro Silver Gold
Gothic Punk Armor Nail Rings For Women Men Adjustable Open Alloy Cross Sword Starburst Aesthetic Jewelry Retro Silver Gold
like
Find Similar
Punk silver open ring with three red enamel flowers in a minimalist stacked design - Silver Red Flower Style(N-1065)
Gothic punk adjustable open ring in silver finish with symmetrical red flame design - Silver Red Double Stone Style(N-1064)
Punk silver split claw open ring featuring a sharp red enamel gemstone accent - Silver Red Single Stone Style(N-1063)
Macro view of gold claw open ring on black leather background with volcanic rock detail - Gold Claw Style(7305)
+6
Gothic Punk Armor Nail Rings For Women Men Adjustable Open Alloy Cross Sword Starburst Aesthetic Jewelry Retro Silver Gold
-6%
$0.24-0.68
No MOQ
 · 
42 sold recently
Vintage Gothic Cross Shield Ring Titanium Steel Punk Hip Hop Signet Ring Distressed Retro Style Men Jewelry For Daily Party
Vintage Gothic Cross Shield Ring Titanium Steel Punk Hip Hop Signet Ring Distressed Retro Style Men Jewelry For Daily Party
like
Find Similar
5 options
Vintage Gothic Cross Shield Ring Titanium Steel Punk Hip Hop Signet Ring Distressed Retro Style Men Jewelry For Daily Party
-4%
$3.14
No MOQ
 · 
12 sold recently
Free Shipping
925 Sterling Silver Minimalist Hollow Out Heart Open Ring For Women Adjustable Dainty Finger Ring Fashion Jewelry Gift
925 Sterling Silver Minimalist Hollow Out Heart Open Ring For Women Adjustable Dainty Finger Ring Fashion Jewelry Gift
like
Find Similar
2 options
925 Sterling Silver Minimalist Hollow Out Heart Open Ring For Women Adjustable Dainty Finger Ring Fashion Jewelry Gift
$17.03
No MOQ
Free Shipping
S925 Sterling Silver Cat Ring Adjustable Open Band Minimalist Cute Animal Kitten Wrap Ring For Women Girls Jewelry Gift
S925 Sterling Silver Cat Ring Adjustable Open Band Minimalist Cute Animal Kitten Wrap Ring For Women Girls Jewelry Gift
like
Find Similar
1 option
S925 Sterling Silver Cat Ring Adjustable Open Band Minimalist Cute Animal Kitten Wrap Ring For Women Girls Jewelry Gift
$10.74
No MOQ
Free Shipping
925 Sterling Silver Bee Honey Couple Rings Adjustable Open Ring Zirconia Inlaid Natural Sweet Style Jewelry For Lovers Gift
925 Sterling Silver Bee Honey Couple Rings Adjustable Open Ring Zirconia Inlaid Natural Sweet Style Jewelry For Lovers Gift
like
Find Similar
Adjustable golden bee ring featuring a sparkling zircon and artistic melting lava design - Adjustable Open / Women's (Bee Design) / Gold
Adjustable S925 sterling silver dripping liquid ring with gold and silver dual-tone finish - Adjustable Open / Men's (Fluid Drip Design) / Silver-Gold Mix
925 Sterling Silver Bee Honey Couple Rings Adjustable Open Ring Zirconia Inlaid Natural Sweet Style Jewelry For Lovers Gift
-17%
$14.16-19.90
No MOQ
 · 
10 views
Free Shipping
Minimalist Stainless Steel Electroplated Ring For Women Niche Design Pleated Bowknot Adjustable Open Ring Fashion Finger Jewelry
Minimalist Stainless Steel Electroplated Ring For Women Niche Design Pleated Bowknot Adjustable Open Ring Fashion Finger Jewelry
like
Find Similar
Golden stainless steel butterfly open ring with polished finish and waterproof design - Butterfly Shape Style (JZ21124)
Waterproof gold stainless steel bow ring with pleated texture and adjustable open band - Pleated Bowknot Style (JZ21311)
Gold butterfly open ring in stainless steel featuring hollow pleated texture and 6.99g weight - Hollow Butterfly Style (JZ21312)
Golden stainless steel bow ring for women featuring dimensions 30.39mm and 19.83mm - Striped Bowknot Style (JZ21424)
+5
Minimalist Stainless Steel Electroplated Ring For Women Niche Design Pleated Bowknot Adjustable Open Ring Fashion Finger Jewelry
$2.04-2.67
No MOQ
Free Shipping
Cyberpunk Gear Ring Stainless Steel Punk Geometric Band Ring For Men Women Industrial Style Fashion Jewelry Gift
Cyberpunk Gear Ring Stainless Steel Punk Geometric Band Ring For Men Women Industrial Style Fashion Jewelry Gift
like
Find Similar
Detail shot of 7mm titanium steel gear ring featuring geometric pyramid texture - US 6 / Gold
Detail showing 7mm wide titanium steel ring with punk gear sawtooth texture - US 6 / Black
Detailed macro view of a 7mm titanium steel gear ring with industrial geometric patterns - US 6 / Silver
+21
Cyberpunk Gear Ring Stainless Steel Punk Geometric Band Ring For Men Women Industrial Style Fashion Jewelry Gift
-4%
$1.00-1.02
No MOQ
 · 
10 sold recently
Free Shipping
Vintage 316 Stainless Steel Wolf Head Ring For Men Women Polished Animal Finger Ring Punk Gothic Biker Jewelry Gift
Vintage 316 Stainless Steel Wolf Head Ring For Men Women Polished Animal Finger Ring Punk Gothic Biker Jewelry Gift
like
Find Similar
Polished black stainless steel wolf head ring with intricate engraved fur details - US 7 / Black
Polished stainless steel wolf head ring with realistic vintage black carvings for men - US 7 / Steel
Polished golden stainless steel wolf head ring with detailed animal carving texture - US 7 / Gold
+18
Vintage 316 Stainless Steel Wolf Head Ring For Men Women Polished Animal Finger Ring Punk Gothic Biker Jewelry Gift
$2.88-3.14
No MOQ
 · 
31 sold recently
Free Shipping
Vintage Titanium Steel Feather Ring For Men Retro Punk Ethnic Inlaid Turquoise Red Black Gemstone Biker Wing Band Jewelry
Vintage Titanium Steel Feather Ring For Men Retro Punk Ethnic Inlaid Turquoise Red Black Gemstone Biker Wing Band Jewelry
like
Find Similar
Vintage boho turquoise feather ring in gold and silver steel with size specs - US 8 / Gold-Silver Turquoise
Retro stainless steel ring for men featuring a large red gemstone and feather texture - US 8 / Steel Red Zircon
Macro shot of vintage titanium steel feather ring with oval black gemstone inlay - US 8 / Steel Color Black Zircon
Macro detail of vintage steel ring featuring carved feathers and a turquoise stone inlay - US 8 / Steel Blue Turquoise
+26
Vintage Titanium Steel Feather Ring For Men Retro Punk Ethnic Inlaid Turquoise Red Black Gemstone Biker Wing Band Jewelry
$3.62-4.14
Mix MOQ : 3
Free Shipping
Vintage Viking Celtic Knot Pentagram Stainless Steel Ring For Men Retro Embossed Hollow Out Band Ring Fashion Jewelry Gift
Vintage Viking Celtic Knot Pentagram Stainless Steel Ring For Men Retro Embossed Hollow Out Band Ring Fashion Jewelry Gift
like
Find Similar
Vintage Viking stainless steel ring featuring Celtic knot and pentagram cutout design - US 7 / Steel
+6
Vintage Viking Celtic Knot Pentagram Stainless Steel Ring For Men Retro Embossed Hollow Out Band Ring Fashion Jewelry Gift
$3.67
No MOQ
Free Shipping
Women Stainless Steel Open Ring Minimalist Enamel Gold Foil Irregular Wave Adjustable Ring Fashion Light Luxury Jewelry
Women Stainless Steel Open Ring Minimalist Enamel Gold Foil Irregular Wave Adjustable Ring Fashion Light Luxury Jewelry
like
Find Similar
Detail of wide gold open ring with white enamel coating and embedded gold foil flakes - Wide Wave Style (R850) / R850-White
Close-up of black enamel ring with gold foil details on a white marble pedestal - Wide Wave Style (R850) / R850-Black
Macro detail of wave gold ring with white enamel inlay and shimmering gold leaf foil flakes - Medium Double Layer Style (R851) / R851-White
Detail of wide wavy gold plated ring with black enamel drip and embedded gold foil flakes - Medium Double Layer Style (R851) / R851-Black
+2
Women Stainless Steel Open Ring Minimalist Enamel Gold Foil Irregular Wave Adjustable Ring Fashion Light Luxury Jewelry
-5%
$1.31
No MOQ
Free Shipping
Viking Celtic Knot Stainless Steel Ring For Men Nordic Vintage Triquetra Band Ring Black Gold Silver Fashion Jewelry Gift
Viking Celtic Knot Stainless Steel Ring For Men Nordic Vintage Triquetra Band Ring Black Gold Silver Fashion Jewelry Gift
like
Find Similar
Vintage Viking Celtic Knot stainless steel ring with black enamel details for men - US 7 / Silver
Macro detail of bicolour Viking Triquetra knot engraved on a vintage titanium steel ring - US 7 / Gold
Men's Nordic Viking Triquetra ring in black stainless steel with vintage knot engravings - US 7 / Black
+15
Viking Celtic Knot Stainless Steel Ring For Men Nordic Vintage Triquetra Band Ring Black Gold Silver Fashion Jewelry Gift
-4%
$1.62
No MOQ
 · 
14 sold recently
Free Shipping
Minimalist 925 Sterling Silver Geometric Hollow Oval Open Ring For Women Personalized INS Style Adjustable Finger Ring Jewelry
Minimalist 925 Sterling Silver Geometric Hollow Oval Open Ring For Women Personalized INS Style Adjustable Finger Ring Jewelry
like
Find Similar
2 options
Minimalist 925 Sterling Silver Geometric Hollow Oval Open Ring For Women Personalized INS Style Adjustable Finger Ring Jewelry
-25%
$18.71
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Fish Pattern Open Ring For Women Cute Animal Motif Finger Ring Fashion Jewelry Daily Gift
Minimalist 925 Sterling Silver Fish Pattern Open Ring For Women Cute Animal Motif Finger Ring Fashion Jewelry Daily Gift
like
Find Similar
Minimalist S925 sterling silver fish ring featuring carved scale patterns on a white background - US Size 5
+4
NewMinimalist 925 Sterling Silver Fish Pattern Open Ring For Women Cute Animal Motif Finger Ring Fashion Jewelry Daily Gift
-4%
$12.17
No MOQ
Free Shipping
Minimalist Wavy Ring Stainless Steel Stackable Band For Women High Polish Wave Design Lightweight Jewelry
Minimalist Wavy Ring Stainless Steel Stackable Band For Women High Polish Wave Design Lightweight Jewelry
like
Find Similar
Minimalist silver wavy titanium steel ring with a polished finish and streamlined design - US 6 / Steel
Minimalist gold-plated titanium steel wave ring with irregular polished finish - US 6 / Gold
Minimalist wave ring with an irregular curved design in polished rose gold finish - US 6 / Rose Gold
+15
Minimalist Wavy Ring Stainless Steel Stackable Band For Women High Polish Wave Design Lightweight Jewelry
-3%
$0.25-0.30
No MOQ
 · 
2K+ sold recently
Top 10% Best Sellers
in Rings
Free Shipping
S925 Sterling Silver Beaded Elastic Ring Apple Sun Smile Flower Charm Korean Minimalist Retro Finger Jewelry For Women
S925 Sterling Silver Beaded Elastic Ring Apple Sun Smile Flower Charm Korean Minimalist Retro Finger Jewelry For Women
like
Find Similar
Minimalist S925 sterling silver beaded ring with a small metal apple-shaped pendant charm - Adjustable Open / Apple Charm Style (1JZ45)
S925 sterling silver beaded ring with a smiling sun pendant on a hand model - Adjustable Open / Sun Smile Charm Style (1JZ45)
S925 sterling silver beaded elastic ring with small floral charm for women - Adjustable Open / Flower Charm Style (1JZ45)
NewS925 Sterling Silver Beaded Elastic Ring Apple Sun Smile Flower Charm Korean Minimalist Retro Finger Jewelry For Women
-6%
$11.79
No MOQ
Free Shipping
Luxury Stainless Steel Star Ring For Women Blessing Engraved Gold Silver Geometric Minimalist Finger Jewelry Decor
Luxury Stainless Steel Star Ring For Women Blessing Engraved Gold Silver Geometric Minimalist Finger Jewelry Decor
like
Find Similar
Gold stainless steel star ring with BLESSING engraving, waterproof and hypoallergenic - US 6 / Gold
Silver star-shaped stainless steel ring engraved with BLESSING lettering in silver - US 6 / Silver
+4
Luxury Stainless Steel Star Ring For Women Blessing Engraved Gold Silver Geometric Minimalist Finger Jewelry Decor
$4.19-4.72
No MOQ
 · 
21 views
Free Shipping
Minimalist 925 Sterling Silver Chain Ring For Women Brushed Bead Pendant Soft Link Finger Ring Korean Style Jewelry
Minimalist 925 Sterling Silver Chain Ring For Women Brushed Bead Pendant Soft Link Finger Ring Korean Style Jewelry
like
Find Similar
S925 sterling silver chain ring featuring a brushed finish metallic bead on textured fabric - 12# / Silver Brushed Bead Chain Ring (JZC093)
Minimalist 925 Sterling Silver Chain Ring For Women Brushed Bead Pendant Soft Link Finger Ring Korean Style Jewelry
-11%
$10.20
No MOQ
Free Shipping
Frosted Stainless Steel Ring For Women Minimalist Titanium Steel Sandblasted Polished Band Elegant Jewelry
Frosted Stainless Steel Ring For Women Minimalist Titanium Steel Sandblasted Polished Band Elegant Jewelry
like
Find Similar
Detail of silver matte titanium steel ring featuring glitter texture and polished inner - US 5 / 2mm Width / Steel
Macro detail of golden titanium steel ring showing frosted texture and polished inner band - US 5 / 2mm Width / Gold
Macro shot of rose gold matte texture finish on a slender titanium steel band - US 5 / 2mm Width / Rose Gold
Minimalist black stainless steel ring featuring a sparkling frosted sandblasted finish - US 5 / 2mm Width / Black
+119
Frosted Stainless Steel Ring For Women Minimalist Titanium Steel Sandblasted Polished Band Elegant Jewelry
$0.13-0.26
No MOQ
 · 
1K+ sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Gothic Punk Alloy Rings For Women Men Antique Silver Color Heart Snake Butterfly Motifs Bohemian Jewelry
Vintage Gothic Punk Alloy Rings For Women Men Antique Silver Color Heart Snake Butterfly Motifs Bohemian Jewelry
like
Find Similar
Bohemian silver ring set featuring snake, flower, and hollow heart designs for women - Bohemian Snake Flower Ring Set 7Pcs / Silver
7-piece silver heart ring set with vintage texture and adjustable open bands for women - Vintage Silver Heart Theme Ring Set / Antique Silver
Vintage silver punk ring set featuring billiard ball and ace of spades designs - Punk Poker No. 8 Ball Ring Set 5Pcs / Antique Silver
Close-up of five-piece silver ring set featuring a butterfly diamond ring on a hand model - Korean Style Butterfly Ring Set 5Pcs / Silver
+43
Vintage Gothic Punk Alloy Rings For Women Men Antique Silver Color Heart Snake Butterfly Motifs Bohemian Jewelry
$0.34-1.41
Mix MOQ : 2
 · 
12 sold recently
Vintage Distressed Titanium Steel Ring For Men Women Eight Pointed Star Pattern Gothic Punk Finger Jewelry Retro Band Ring
Vintage Distressed Titanium Steel Ring For Men Women Eight Pointed Star Pattern Gothic Punk Finger Jewelry Retro Band Ring
like
Find Similar
Silver punk steel ring with black matte band and golden star patterns for men and women - US 7 / Gold & Silver
Punk style wide silver titanium steel ring featuring embossed octagonal star patterns - US 7 / Steel
+10
Vintage Distressed Titanium Steel Ring For Men Women Eight Pointed Star Pattern Gothic Punk Finger Jewelry Retro Band Ring
$3.14-3.41
No MOQ
Free Shipping
Vintage Hammered Titanium Steel Ring For Men Women Irregular Geometric Punk Style Band Ring Minimalist Jewelry Gift
Vintage Hammered Titanium Steel Ring For Men Women Irregular Geometric Punk Style Band Ring Minimalist Jewelry Gift
like
Find Similar
Macro shot of silver-tone ring showing hammered texture and irregular metal surface - US 6 / Silver
Hammered texture gold titanium steel ring with minimalist punk style for men and women - US 6 / Gold
Handmade hammered texture punk style black titanium steel ring for men and women - US 6 / Black
Detail of hand-hammered irregular texture on punk style titanium steel ring band - US 6 / Antique Silver
+28
Vintage Hammered Titanium Steel Ring For Men Women Irregular Geometric Punk Style Band Ring Minimalist Jewelry Gift
-5%
$2.24-2.49
No MOQ
Free Shipping
S925 Sterling Silver Double Butterfly Open Ring Women Sweet Adjustable Irregular Texture Ring Elegant Light Luxury Jewelry Accessory
S925 Sterling Silver Double Butterfly Open Ring Women Sweet Adjustable Irregular Texture Ring Elegant Light Luxury Jewelry Accessory
like
Find Similar
Elegant S925 silver double butterfly open ring with textured wings and branch-like band - Adjustable Open / Silver
S925 Sterling Silver Double Butterfly Open Ring Women Sweet Adjustable Irregular Texture Ring Elegant Light Luxury Jewelry Accessory
$13.62
No MOQ
Free Shipping
Fashion Adjustable Open Ring Gold Plated Copper Colorful Enamel Flower Smiley Face Finger Jewelry For Women Girls Daily Wear
Fashion Adjustable Open Ring Gold Plated Copper Colorful Enamel Flower Smiley Face Finger Jewelry For Women Girls Daily Wear
like
Find Similar
Fashionable colorful enamel smiley flower open ring in 18k gold plated finish - Multicolor Petal Style (11770)
Macro shot of gold-plated flower ring with white enamel petals and a black smiley face - White Petal Style (11771)
Close-up detail of a yellow floral smiley face open ring with 18k gold plating - Yellow Petal Style (11772)
Close-up of gold-plated open ring featuring an orange enamel smiley face flower - Orange Petal Style (11774)
+2
Fashion Adjustable Open Ring Gold Plated Copper Colorful Enamel Flower Smiley Face Finger Jewelry For Women Girls Daily Wear
$1.18
No MOQ
Free Shipping
Men's Vintage Pirate Skull Crossed Swords Stainless Steel Ring Punk Hip Hop Two-tone Gold Silver Gothic Biker Jewelry Gift
Men's Vintage Pirate Skull Crossed Swords Stainless Steel Ring Punk Hip Hop Two-tone Gold Silver Gothic Biker Jewelry Gift
like
Find Similar
Punk style stainless steel pirate skull ring featuring crossed swords and ship wheel details - US 7 / Steel
Vintage stainless steel pirate skull ring for men with golden cross swords design - US 7 / Gold & Silver
+12
Men's Vintage Pirate Skull Crossed Swords Stainless Steel Ring Punk Hip Hop Two-tone Gold Silver Gothic Biker Jewelry Gift
-4%
$2.96-3.21
No MOQ
Free Shipping
Butterfly Open Ring Alloy Rhinestone Asymmetric Adjustable Sparkly Jewelry For Women Girls Silver Color
Butterfly Open Ring Alloy Rhinestone Asymmetric Adjustable Sparkly Jewelry For Women Girls Silver Color
like
Find Similar
Silver adjustable double butterfly ring featuring shimmering crystals for women - M256 Butterfly Open Ring
Butterfly Open Ring Alloy Rhinestone Asymmetric Adjustable Sparkly Jewelry For Women Girls Silver Color
$0.13
No MOQ
 · 
1K+ sold recently
Minimalist Stainless Steel Signet Ring For Men Women Square Round Heart Geometric Polished Band Gold Silver Black Jewelry
Minimalist Stainless Steel Signet Ring For Men Women Square Round Heart Geometric Polished Band Gold Silver Black Jewelry
like
Find Similar
Polished gold square signet ring for men with 18mm flat round surface dimensions - US 6 / Gold (13-B-1)
Men's matte black square solid signet ring in stainless steel with 18mm flat round top - US 6 / Black (13-B-2)
Polished silver stainless steel signet ring with 18mm flat square surface for men - US 6 / Steel (13-B-3)
Polished gold heart signet ring in stainless steel with 15mm by 18mm face dimensions - US 6 / Gold Heart (13-C-1)
+210
Minimalist Stainless Steel Signet Ring For Men Women Square Round Heart Geometric Polished Band Gold Silver Black Jewelry
$1.02-1.40
No MOQ
Free Shipping
Hip Hop Roaring Lion Head Ring For Men Vintage Stainless Steel Animal Statement Ring Punk Rock Biker Band Finger Jewelry
Hip Hop Roaring Lion Head Ring For Men Vintage Stainless Steel Animal Statement Ring Punk Rock Biker Band Finger Jewelry
like
Find Similar
Polished stainless steel roaring lion head ring with bold hip hop style design - US 7 / Steel
Gothic 3D roaring tiger head ring in oxidized stainless steel with vintage finish - US 7 / Black
Mens hip hop golden lion head ring with realistic carved details in stainless steel - US 7 / Gold
+18
Hip Hop Roaring Lion Head Ring For Men Vintage Stainless Steel Animal Statement Ring Punk Rock Biker Band Finger Jewelry
$3.14-3.41
No MOQ
Free Shipping
Vintage Heart Open Ring For Women Sweety Copper White Gold Plated Hollow Heart Adjustable Finger Ring Fashion Jewelry Accessory
Vintage Heart Open Ring For Women Sweety Copper White Gold Plated Hollow Heart Adjustable Finger Ring Fashion Jewelry Accessory
like
Find Similar
Minimalist silver heart-shaped ring with beaded edges worn on finger - Adjustable Open / 3D Large Heart Ring
Vintage silver heart open ring with intricate wire wrap detail on female hand - Adjustable Open / Hollow Heart Ring
Vintage Heart Open Ring For Women Sweety Copper White Gold Plated Hollow Heart Adjustable Finger Ring Fashion Jewelry Accessory
-4%
$0.85-0.90
No MOQ
Snake Ring Rotatable Titanium Steel Punk Gothic Animal Head Scale Texture Vintage Trendy Jewelry For Men Unisex
Snake Ring Rotatable Titanium Steel Punk Gothic Animal Head Scale Texture Vintage Trendy Jewelry For Men Unisex
like
Find Similar
Golden stainless steel snake spinner ring with black gemstone eyes on white background - US 6 / Gold
Mens vintage stainless steel spinner ring with engraved snake pattern and black zircon eye - US 6 / Silver
Men's black stainless steel spinning snake ring with detailed scale engraving and stone eye - US 6 / Black
+21
Snake Ring Rotatable Titanium Steel Punk Gothic Animal Head Scale Texture Vintage Trendy Jewelry For Men Unisex
-4%
$2.62-2.87
No MOQ
 · 
167 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access