Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Fashion Adjustable Rainbow Rhinestone Open Ring For Women Copper Gold Silver Plated Colorful Stone Inlaid Commuter Ring Jewelry
Fashion Adjustable Rainbow Rhinestone Open Ring For Women Copper Gold Silver Plated Colorful Stone Inlaid Commuter Ring Jewelry
like
Find Similar
Rainbow gemstone open ring with colorful rectangular crystals in silver setting - Silver (L5310)
Detail of a rainbow gemstone open ring with multi-color rectangular-cut zircons and gold base - Gold (D9310)
Fashion Adjustable Rainbow Rhinestone Open Ring For Women Copper Gold Silver Plated Colorful Stone Inlaid Commuter Ring Jewelry
$1.44
Mix MOQ : 2
Free Shipping
Men's Punk Style Titanium Steel Ring With Large Rectangular Rhinestone Black Plated Horseshoe Carved Fashion Finger Ring
Men's Punk Style Titanium Steel Ring With Large Rectangular Rhinestone Black Plated Horseshoe Carved Fashion Finger Ring
like
Find Similar
Men's punk style black plated ring with large square cut red ruby-colored gemstone - US 7 / Black/Red Zirconia
Detail of square emerald green stone and horseshoe relief on black punk ring - US 7 / Black/Green Zirconia
Men's punk style black stainless steel ring with a large square cut blue crystal stone - US 7 / Black/Blue Zirconia
Men's punk style black coated ring with a large square clear gemstone and side relief - US 7 / Black/White Zirconia
+38
Men's Punk Style Titanium Steel Ring With Large Rectangular Rhinestone Black Plated Horseshoe Carved Fashion Finger Ring
$3.24
No MOQ
Free Shipping
S925 Sterling Silver Adjustable Rings For Women Minimalist Open Finger Ring Heart Shape Intertwined Cross Line Daily Jewelry
S925 Sterling Silver Adjustable Rings For Women Minimalist Open Finger Ring Heart Shape Intertwined Cross Line Daily Jewelry
like
Find Similar
Detailed macro view of S925 sterling silver heart wreath ring in a gift box - Heart Style
NewS925 Sterling Silver Adjustable Rings For Women Minimalist Open Finger Ring Heart Shape Intertwined Cross Line Daily Jewelry
$10.90
No MOQ
Free Shipping
Vintage French Stainless Steel Heart Open Ring Adjustable Enamel Drip Oil Twist Rope Design Jewelry For Women Dating
Vintage French Stainless Steel Heart Open Ring Adjustable Enamel Drip Oil Twist Rope Design Jewelry For Women Dating
like
Find Similar
Detailed view of vintage French heart ring with black enamel and rope texture on silk - Silver Base Black Heart (J615-S-B)
Macro detail of vintage gold heart ring featuring white oil drip and twisted rope band - Gold Base White Heart (J615-G-W)
Detail shot of vintage heart ring with black enamel and gold rope band measurements - Gold Base Black Heart (J615-G-B)
Vintage French Stainless Steel Heart Open Ring Adjustable Enamel Drip Oil Twist Rope Design Jewelry For Women Dating
$0.78-1.05
Mix MOQ : 2
 · 
1 reviews
Free Shipping
Luxury Colorful Zirconia Copper Open Ring Rainbow Stones X Cross Pattern Adjustable Fashion Jewelry For Women Finger Ring
Luxury Colorful Zirconia Copper Open Ring Rainbow Stones X Cross Pattern Adjustable Fashion Jewelry For Women Finger Ring
like
Find Similar
Luxurious gold ring featuring rainbow zircon stones and an elegant cross X design - Gold (D8525)
Elegant silver open ring with colorful zircon stones and criss-cross metal X pattern - Silver (D8525)
Luxury Colorful Zirconia Copper Open Ring Rainbow Stones X Cross Pattern Adjustable Fashion Jewelry For Women Finger Ring
$1.83
Mix MOQ : 2
Free Shipping
Minimalist Stainless Steel Beveled Edge Geometric Ring For Men Women Gold Silver Black Polished Band Fashion Jewelry Gift
Minimalist Stainless Steel Beveled Edge Geometric Ring For Men Women Gold Silver Black Polished Band Fashion Jewelry Gift
like
Find Similar
Macro detail of gold-plated punk style ring featuring geometric multi-faceted edges - US 6 / Gold
Detailed view of punk style stainless steel ring with geometric faceted beveled edges - US 6 / Silver
Macro view of polished black faceted stainless steel ring with modern geometric angles - US 6 / Black
+21
Minimalist Stainless Steel Beveled Edge Geometric Ring For Men Women Gold Silver Black Polished Band Fashion Jewelry Gift
-4%
$0.62-0.70
No MOQ
 · 
15 sold recently
Free Shipping
S925 Sterling Silver Bowknot Ring For Women Minimalist Polished Adjustable Open Finger Ring Fashion Daily Jewelry Gift
S925 Sterling Silver Bowknot Ring For Women Minimalist Polished Adjustable Open Finger Ring Fashion Daily Jewelry Gift
like
Find Similar
2 options
NewS925 Sterling Silver Bowknot Ring For Women Minimalist Polished Adjustable Open Finger Ring Fashion Daily Jewelry Gift
$16.24
No MOQ
Free Shipping
Punk Vintage Alloy Rabbit Head Open Ring For Men Women Retro Silver Animal Gothic Adjustable Finger Ring Personalized Fashion Jewelry
Punk Vintage Alloy Rabbit Head Open Ring For Men Women Retro Silver Animal Gothic Adjustable Finger Ring Personalized Fashion Jewelry
like
Find Similar
Vintage punk style rabbit open ring made of silver alloy, 30mm height and 10g weight - Silver
Punk Vintage Alloy Rabbit Head Open Ring For Men Women Retro Silver Animal Gothic Adjustable Finger Ring Personalized Fashion Jewelry
$0.73
Mix MOQ : 2
Free Shipping
S925 Sterling Silver Rainbow Zirconia Adjustable Open Ring For Women Minimalist Dainty Colorful Stackable Band Ring Jewelry
S925 Sterling Silver Rainbow Zirconia Adjustable Open Ring For Women Minimalist Dainty Colorful Stackable Band Ring Jewelry
like
Find Similar
Minimalist S925 silver adjustable ring with braided band and rainbow cubic zirconia stones - Adjustable Open / Plain Silver (Multicolor Stone)
S925 Sterling Silver Rainbow Zirconia Adjustable Open Ring For Women Minimalist Dainty Colorful Stackable Band Ring Jewelry
$7.44
No MOQ
Free Shipping
Minimalist Geometric Stainless Steel Rings For Women Gold Plated Waterproof Non Fading Fashionable Band Accessory
Minimalist Geometric Stainless Steel Rings For Women Gold Plated Waterproof Non Fading Fashionable Band Accessory
like
Find Similar
Detailed view of square 18K gold plated stainless steel signet ring with 18mm face height - US 6 / Gold Large Wide Signet Ring (HC-R30002)
Detailed view of gold plated stainless steel ring with 10mm width and 3mm thickness specs - US 6 / Gold Minimalist Arc Ring (HC-R30003)
Detailed specs of gold round signet ring featuring 12mm face diameter and 5.0g weight - US 6 / Gold Round Signet Ring (HC-R30005)
Detailed view of square gold ring with dimensions 16mm x 4.5mm and weight of 3.8g - US 6 / Gold Minimalist Profile Ring (HC-R30006)
+15
Minimalist Geometric Stainless Steel Rings For Women Gold Plated Waterproof Non Fading Fashionable Band Accessory
$2.10-4.72
No MOQ
 · 
40 sold recently
Free Shipping
Vintage Stainless Steel Square Gemstone Ring For Men Punk Gothic Signet Ring Geometric Cross Ring Jewelry Accessory Gift
Vintage Stainless Steel Square Gemstone Ring For Men Punk Gothic Signet Ring Geometric Cross Ring Jewelry Accessory Gift
like
Find Similar
Polished silver signet ring for men with square tiger eye stone inlay and industrial style - US 7 / Tiger Eye Stone Ring
Vintage silver titanium ring featuring a large square purple gemstone on reflective surface - US 7 / Purple Gemstone Ring
Men's vintage signet ring in silver stainless steel with a square black gemstone inlay - US 7 / Black Gem Ring
+15
Vintage Stainless Steel Square Gemstone Ring For Men Punk Gothic Signet Ring Geometric Cross Ring Jewelry Accessory Gift
-5%
$3.73
No MOQ
Free Shipping
Vintage Bohemian Rings Alloy Turquoise Sun Moon Star Evil Eye Geometric Stackable Joint Jewelry For Women Men
Vintage Bohemian Rings Alloy Turquoise Sun Moon Star Evil Eye Geometric Stackable Joint Jewelry For Women Men
like
Find Similar
Vintage silver bohemian ring set featuring black gemstones and ethnic engraved motifs - Vintage Punk 9Pcs Set (22495-silver)
Antique silver butterfly and floral bohemian rings set for women vintage gothic jewelry - Boho Butterfly Floral 9Pcs Set (22639-silver)
Bohemian style vintage silver ring set featuring evil eye, moon, and pearl details - Moon Star Evil Eye Vintage Set (25530-silver)
Retro silver ring set with butterfly, moon, and heart charms in bohemian style - Butterfly Bee Vintage 16Pcs Set (26421-silver)
+9
Vintage Bohemian Rings Alloy Turquoise Sun Moon Star Evil Eye Geometric Stackable Joint Jewelry For Women Men
$0.79-1.83
Mix MOQ : 2
Free Shipping
Vintage Men Titanium Steel Shield Ring Black Epoxy Mirror Polished Industrial Punk Style Band Ring For Party Daily Jewelry
Vintage Men Titanium Steel Shield Ring Black Epoxy Mirror Polished Industrial Punk Style Band Ring For Party Daily Jewelry
like
Find Similar
Titanium steel men's ring with black drip glue inlay and hammered texture on black base - US 7 / Steel Black
+4
Vintage Men Titanium Steel Shield Ring Black Epoxy Mirror Polished Industrial Punk Style Band Ring For Party Daily Jewelry
$3.93
No MOQ
Free Shipping
Hip Hop Personalized Stainless Steel Plain Band Ring For Men Three-Layer Groove Design Polished Geometric Hand Jewelry Gift
Hip Hop Personalized Stainless Steel Plain Band Ring For Men Three-Layer Groove Design Polished Geometric Hand Jewelry Gift
like
Find Similar
Polished rose gold titanium steel triple-band ring for men in hip-hop style - Size 7 / Rose Gold (21-C-1)
Polished silver titanium steel ring with triple groove design for men in hip-hop style - Size 7 / Steel Color (21-C-1)
Minimalist polished gold titanium steel band ring with unique triple grooved design - Size 7 / Gold (21-C-1)
+18
Hip Hop Personalized Stainless Steel Plain Band Ring For Men Three-Layer Groove Design Polished Geometric Hand Jewelry Gift
$0.26-0.39
No MOQ
 · 
323 sold recently
Free Shipping
925 Sterling Silver Butterfly Open Ring For Women Adjustable Zirconia Inlaid Index Finger Ring Elegant Light Luxury Jewelry
925 Sterling Silver Butterfly Open Ring For Women Adjustable Zirconia Inlaid Index Finger Ring Elegant Light Luxury Jewelry
like
Find Similar
Elegant S925 sterling silver butterfly open ring with sparkling cubic zirconia stones - 925 Silver / White Gold
New925 Sterling Silver Butterfly Open Ring For Women Adjustable Zirconia Inlaid Index Finger Ring Elegant Light Luxury Jewelry
$12.84
No MOQ
Free Shipping
Vintage Handcrafted Natural Druzy Geode Crystal Agate Adjustable Open Ring For Women Men Electroplated Silver Statement Jewelry
Vintage Handcrafted Natural Druzy Geode Crystal Agate Adjustable Open Ring For Women Men Electroplated Silver Statement Jewelry
like
Find Similar
Detailed view of large raw geode agate stone with handcrafted silver plated wire wrap band - One Size / Crystal Geode
Detailed macro of a vintage geode crystal ring with antique silver soldered band - One Size / Agate Geode
Vintage Handcrafted Natural Druzy Geode Crystal Agate Adjustable Open Ring For Women Men Electroplated Silver Statement Jewelry
-12%
$4.15
No MOQ
 · 
27 sold recently
Free Shipping
Minimalist Stainless Steel Engraved Ring For Couples Men Women Rhinestone Inlaid Starry Sky Band Ring Valentine's Day Jewelry
Minimalist Stainless Steel Engraved Ring For Couples Men Women Rhinestone Inlaid Starry Sky Band Ring Valentine's Day Jewelry
like
Find Similar
Rose gold stainless steel couple ring with Calvin Keith engraved text for women and men - US 5 / Rose Gold without Rhinestones
Minimalist stainless steel couple ring featuring polished finish and engraved lettering - US 5 / Steel without Diamonds
Macro detail of rose gold sparkling ring with pavé crystals and inner brand engraving - US 5 / Rose Gold Starry Sky
Detailed close-up of a silver stainless steel ring featuring a sparkling pavé diamond band - US 5 / Rhinestone Silver
+26
Minimalist Stainless Steel Engraved Ring For Couples Men Women Rhinestone Inlaid Starry Sky Band Ring Valentine's Day Jewelry
$1.18-2.75
No MOQ
Free Shipping
S925 Sterling Silver Triple Layer Circular Beads Stretchable Chain Ring For Women Glistening Stackable Adjustable Finger Jewelry
S925 Sterling Silver Triple Layer Circular Beads Stretchable Chain Ring For Women Glistening Stackable Adjustable Finger Jewelry
like
Find Similar
Sparkling S925 sterling silver triple-layer beaded ring with adjustable slide chain - Adjustable Open / Silver
S925 Sterling Silver Triple Layer Circular Beads Stretchable Chain Ring For Women Glistening Stackable Adjustable Finger Jewelry
-11%
$10.45
No MOQ
Free Shipping
Punk Gothic Titanium Steel Stacked Skull Ring Men Vintage Distressed Gold Silver Color Skeleton Biker Finger Ring Jewelry
Punk Gothic Titanium Steel Stacked Skull Ring Men Vintage Distressed Gold Silver Color Skeleton Biker Finger Ring Jewelry
like
Find Similar
Vintage silver stackable skull ring in stainless steel for punk and rock style jewelry - US 7 / Steel
Golden punk skull ring made of polished stainless steel featuring bold gothic carvings - US 7 / Gold
+10
Punk Gothic Titanium Steel Stacked Skull Ring Men Vintage Distressed Gold Silver Color Skeleton Biker Finger Ring Jewelry
-5%
$3.24-3.48
No MOQ
 · 
10 views
Free Shipping
925 Sterling Silver Enamel Adjustable Open Ring With Cubic Zirconia Candy Color Minimalist Fashion Jewelry For Women Gift
925 Sterling Silver Enamel Adjustable Open Ring With Cubic Zirconia Candy Color Minimalist Fashion Jewelry For Women Gift
like
Find Similar
Adjustable S925 sterling silver ring with vibrant blue enamel and sparkling zircons - 925 Silver / Blue
Pink enamel S925 sterling silver open ring with three small sparkling diamonds for women - 925 Silver / Pink
925 Sterling Silver Enamel Adjustable Open Ring With Cubic Zirconia Candy Color Minimalist Fashion Jewelry For Women Gift
$10.84
No MOQ
 · 
13 views
Free Shipping
Vintage Stainless Steel Freemasonry Ring For Men Master Mason Signet Ring G Symbol Polished Punk Jewelry Gold Silver Two-Tone
Vintage Stainless Steel Freemasonry Ring For Men Master Mason Signet Ring G Symbol Polished Punk Jewelry Gold Silver Two-Tone
like
Find Similar
Detail of Freemason ring with gold-tone square and compass relief on silver band - US 7 / Two-tone (Gold & Silver)
Vintage stainless steel Freemasonry signet ring with compass G logo and engraved text - US 7 / Steel
Gold stainless steel Master Mason ring with black enamel and Freemasonry square logo - US 7 / All Gold
+21
Vintage Stainless Steel Freemasonry Ring For Men Master Mason Signet Ring G Symbol Polished Punk Jewelry Gold Silver Two-Tone
-4%
$2.87-3.12
No MOQ
 · 
11 sold recently
Free Shipping
Adjustable Open Ring Copper 18K Gold Plated Zircon Flower Four Leaf Clover Beaded Texture Elegant Jewelry For Women
Adjustable Open Ring Copper 18K Gold Plated Zircon Flower Four Leaf Clover Beaded Texture Elegant Jewelry For Women
like
Find Similar
18K gold plated clover ring with red zircon flower charms and adjustable bead band - Adjustable Open / Red
Adjustable 18K gold-plated ring with green zircon clover flowers and vintage bead texture - Adjustable Open / Green
18K gold plated copper flower ring with zircons and beaded band on warm background - Adjustable Open / White
Detail of 18K gold plated clover ring with dark blue zircon and beaded texture - Adjustable Open / Blue
Adjustable Open Ring Copper 18K Gold Plated Zircon Flower Four Leaf Clover Beaded Texture Elegant Jewelry For Women
$1.78
No MOQ
 · 
47 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
925 Sterling Silver Daisy Flower Ring Oxidized Vintage Minimalist Western Style Women Fashion Jewelry Finger Ring
925 Sterling Silver Daisy Flower Ring Oxidized Vintage Minimalist Western Style Women Fashion Jewelry Finger Ring
like
Find Similar
Retro S925 sterling silver daisy flower wrap ring with oxidized vintage finish for women - US Size 5 / Silver / [product Attributes] This Product Is A [silver Daisy Continuous Ring] Designed With Multiple Small Flowers Encircling It. Visually It Appears To Use An [antique/vintage Process] Effectively Highlighting The Texture And Layering Of The Petals. The Material Appears To Be [silver-plated White Copper Or 925 Silver].
+5
925 Sterling Silver Daisy Flower Ring Oxidized Vintage Minimalist Western Style Women Fashion Jewelry Finger Ring
$15.33
No MOQ
Free Shipping
Luxury 925 Sterling Silver Square Halo Ring For Women Fashionable Adjustable Chain Design Zirconia Inlaid Open Finger Ring Jewelry
Luxury 925 Sterling Silver Square Halo Ring For Women Fashionable Adjustable Chain Design Zirconia Inlaid Open Finger Ring Jewelry
like
Find Similar
Macro view of silver chain design ring with round brilliant cut white gemstone inlay - Adjustable Open / White Gold
Luxury 925 Sterling Silver Square Halo Ring For Women Fashionable Adjustable Chain Design Zirconia Inlaid Open Finger Ring Jewelry
$13.05
No MOQ
Free Shipping
925 Sterling Silver Irregular Twisted Wrapping Open Adjustable Ring For Women Minimalist Geometric Lines Jewelry Gift
925 Sterling Silver Irregular Twisted Wrapping Open Adjustable Ring For Women Minimalist Geometric Lines Jewelry Gift
like
Find Similar
Irregular interwoven S925 sterling silver ring with textured braided rope design - Size 13 (Adjustable) / Irregular Twisted Wrapping (JZ1607) / Silver
925 Sterling Silver Irregular Twisted Wrapping Open Adjustable Ring For Women Minimalist Geometric Lines Jewelry Gift
-15%
$19.47
No MOQ
Free Shipping
Vintage Titanium Steel Men's Ring Square Red Black Purple Rhinestone Inlaid Gothic Punk Style Biker Finger Ring Jewelry
Vintage Titanium Steel Men's Ring Square Red Black Purple Rhinestone Inlaid Gothic Punk Style Biker Finger Ring Jewelry
like
Find Similar
Vintage men's titanium steel ring with black square gemstone and gothic scroll engraving - US 7 / Steel Black
Vintage men's titanium steel ring with square purple gemstone and ornate carvings - US 7 / Purple
Men's vintage titanium steel ring with square red gemstone and scroll engravings - US 7 / Red
+15
Vintage Titanium Steel Men's Ring Square Red Black Purple Rhinestone Inlaid Gothic Punk Style Biker Finger Ring Jewelry
$4.98
No MOQ
Free Shipping
Vintage 925 Sterling Silver Pig Nose Chain Open Ring Adjustable 18K Gold Plated Geometric Link Finger Ring For Women Jewelry
Vintage 925 Sterling Silver Pig Nose Chain Open Ring Adjustable 18K Gold Plated Geometric Link Finger Ring For Women Jewelry
like
Find Similar
2 options
Vintage 925 Sterling Silver Pig Nose Chain Open Ring Adjustable 18K Gold Plated Geometric Link Finger Ring For Women Jewelry
-29%
$17.17
No MOQ
Free Shipping
S925 Sterling Silver Wave Ring For Women Minimalist Zirconia Inlaid Commuter Geometric Finger Ring Fashion Delicate Jewelry
S925 Sterling Silver Wave Ring For Women Minimalist Zirconia Inlaid Commuter Geometric Finger Ring Fashion Delicate Jewelry
like
Find Similar
4 options
S925 Sterling Silver Wave Ring For Women Minimalist Zirconia Inlaid Commuter Geometric Finger Ring Fashion Delicate Jewelry
$10.43
No MOQ
Free Shipping
Hip Hop Iced Out Full Rhinestone Stainless Steel Ring For Men Octagonal Polished Gold Plated Signet Finger Ring Jewelry
Hip Hop Iced Out Full Rhinestone Stainless Steel Ring For Men Octagonal Polished Gold Plated Signet Finger Ring Jewelry
like
Find Similar
Men's hip hop octagonal ring in silver stainless steel with full pavé cz stones - Size 7 / Steel
Iced out octagonal gold ring for men with micro-paved cubic zirconia in hip hop style - Size 7 / Gold
+12
Hip Hop Iced Out Full Rhinestone Stainless Steel Ring For Men Octagonal Polished Gold Plated Signet Finger Ring Jewelry
$3.93-4.45
No MOQ
Free Shipping
Minimalist Stainless Steel 18K Gold Plated Rings For Women Irregular Wave Lava Pattern Open Adjustable Finger Rings Fashion Jewelry
Minimalist Stainless Steel 18K Gold Plated Rings For Women Irregular Wave Lava Pattern Open Adjustable Finger Rings Fashion Jewelry
like
Find Similar
Detail of 18K gold plated stainless steel rings set showing irregular wave patterns - Gold Irregular Wave Ring Set (JDR0311107-2pcs)
Minimalist Stainless Steel 18K Gold Plated Rings For Women Irregular Wave Lava Pattern Open Adjustable Finger Rings Fashion Jewelry
$4.06
No MOQ
Free Shipping
Stainless Steel Ring Plain Band Minimalist Simple Polished Brushed Jewelry For Men Women Trendy Cool Smooth Unisex
Stainless Steel Ring Plain Band Minimalist Simple Polished Brushed Jewelry For Men Women Trendy Cool Smooth Unisex
like
Find Similar
Macro shot of 8mm wide polished black minimalist ring with a smooth reflective finish - US 5 / 8mm Width / Black
Minimalist stainless steel ring in rose gold finish with smooth polished surface - US 13 / 2mm Width / Rose Gold
Polished black stainless steel wide band ring with mirror finish on wooden background - US 5 / 12mm Width / Black
Macro shot of wide curved silver stainless steel ring with polished metallic finish - US 6 / 8mm Width / Steel
+238
Stainless Steel Ring Plain Band Minimalist Simple Polished Brushed Jewelry For Men Women Trendy Cool Smooth Unisex
$0.08-0.39
No MOQ
 · 
2K+ sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Vintage Gothic Dragon Claw Ring For Men Women Domineering Titanium Steel Oxidized Silver Punk Style Statement Ring Jewelry
Vintage Gothic Dragon Claw Ring For Men Women Domineering Titanium Steel Oxidized Silver Punk Style Statement Ring Jewelry
like
Find Similar
Vintage dragon claw ring for men in retro oxidized stainless steel gothic style - US 7 / Antique Silver
+6
Vintage Gothic Dragon Claw Ring For Men Women Domineering Titanium Steel Oxidized Silver Punk Style Statement Ring Jewelry
$3.14
No MOQ
Free Shipping
Vintage Multicolor Zircon Open Adjustable Ring For Women Silver Plated Copper Holographic Stone Bohemian Gorgeous Jewelry Finger Ring
Vintage Multicolor Zircon Open Adjustable Ring For Women Silver Plated Copper Holographic Stone Bohemian Gorgeous Jewelry Finger Ring
like
Find Similar
Detailed macro shot of textured silver ring with colorful oval zircon and heart accents - Colorful Zirconia / Silver Style
Vintage Multicolor Zircon Open Adjustable Ring For Women Silver Plated Copper Holographic Stone Bohemian Gorgeous Jewelry Finger Ring
-5%
$1.24
No MOQ
Free Shipping
Minimalist Stainless Steel Plain Band Ring 18K Gold Plated Polished Geometric Finger Jewelry For Women
Minimalist Stainless Steel Plain Band Ring 18K Gold Plated Polished Geometric Finger Jewelry For Women
like
Find Similar
Minimalist 18K gold plated stainless steel plain band ring for women on white background - 2mm / US 5 / Gold
Minimalist 18K gold plated stainless steel plain ring with a polished smooth finish - 4mm / US 5 / Gold
Elegant 18K gold plated minimalist stainless steel band ring for women in studio lighting - 6mm / US 5 / Gold
Minimalist polished stainless steel ring in silver finish for women fashion - 2mm / US 5 / Silver
+32
Minimalist Stainless Steel Plain Band Ring 18K Gold Plated Polished Geometric Finger Jewelry For Women
$0.63-1.35
No MOQ
 · 
2K+ sold recently
Free Shipping
925 Sterling Silver Snake Open Ring Adjustable Green Eye Rhinestone Animal Wrap Finger Ring Fashion Jewelry For Women
925 Sterling Silver Snake Open Ring Adjustable Green Eye Rhinestone Animal Wrap Finger Ring Fashion Jewelry For Women
like
Find Similar
S925 sterling silver snake ring with pavé white zircons and green gemstone eyes - US Size 5 / Silver
Minimalist S925 sterling silver snake ring in gold finish with white and green stones - US Size 5 / Gold
+8
925 Sterling Silver Snake Open Ring Adjustable Green Eye Rhinestone Animal Wrap Finger Ring Fashion Jewelry For Women
$17.81
No MOQ
Free Shipping
Vintage Stainless Steel Celtic Knot Signet Ring For Men Women Retro Punk Gothic Oxidized Silver Tone Band Ring Jewelry Gift
Vintage Stainless Steel Celtic Knot Signet Ring For Men Women Retro Punk Gothic Oxidized Silver Tone Band Ring Jewelry Gift
like
Find Similar
Vintage silver-toned signet ring with Celtic knot motif and twisted rope edge details - US 7 / Silver
+5
Vintage Stainless Steel Celtic Knot Signet Ring For Men Women Retro Punk Gothic Oxidized Silver Tone Band Ring Jewelry Gift
$3.14
No MOQ
Free Shipping
Minimalist Titanium Steel Domed Band Ring For Men Women High Polished Simple Classic Couple Jewelry Gift Gold Silver Black Rose Gold Multicolor
Minimalist Titanium Steel Domed Band Ring For Men Women High Polished Simple Classic Couple Jewelry Gift Gold Silver Black Rose Gold Multicolor
like
Find Similar
Pair of 6mm minimalist polished stainless steel couple rings on a dark textured background - US 5 / Silver
Close-up of a smooth rainbow gradient stainless steel ring with vibrant metallic luster - US 5 / Rainbow
Macro detail of high-polish black ring showing smooth inner arc and mirror-like surface - US 5 / Black
Polished 6mm gold titanium steel minimalist band rings on black leather background - US 5 / Gold
+41
Minimalist Titanium Steel Domed Band Ring For Men Women High Polished Simple Classic Couple Jewelry Gift Gold Silver Black Rose Gold Multicolor
$0.18-0.31
No MOQ
 · 
692 sold recently
Sun Moon Cross Alloy Rhinestone Open Rings For Women Couples Adjustable Fashion Finger Ring Jewelry Personalized Jewelry Gift
Sun Moon Cross Alloy Rhinestone Open Rings For Women Couples Adjustable Fashion Finger Ring Jewelry Personalized Jewelry Gift
like
Find Similar
Close-up of rose gold criss-cross ring with sparkling zircon stones on soft background - Multi-loop Cross Design / Rose Gold
Close-up of golden multi-layer crisscross ring with rectangle and round diamonds - Crossed Design Style / Gold
Black stacked multi-layer open ring featuring sparkling clear zircon crystal stones - Multi-loop Interlaced Style / Black
Detail shot of silver multi-layer crossover ring with sparkling crystals and adjustable band - Multi Layer Rhinestone Style / Silver
+8
Sun Moon Cross Alloy Rhinestone Open Rings For Women Couples Adjustable Fashion Finger Ring Jewelry Personalized Jewelry Gift
$0.63-0.92
No MOQ
 · 
29 views
Free Shipping
925 Sterling Silver Beaded Ring For Women Vintage Brushed Texture Adjustable Elastic Cord Minimalist Korean Style Finger Ring Jewelry
925 Sterling Silver Beaded Ring For Women Vintage Brushed Texture Adjustable Elastic Cord Minimalist Korean Style Finger Ring Jewelry
like
Find Similar
Minimalist S925 sterling silver beaded ring with red stones on a wooden branch - Adjustable Open / Red (1JZ74-SG)
Minimalist S925 sterling silver beaded stretch ring with brushed texture center bead - Adjustable Open / Black (1JZ74-SG)
925 Sterling Silver Beaded Ring For Women Vintage Brushed Texture Adjustable Elastic Cord Minimalist Korean Style Finger Ring Jewelry
-11%
$9.71
No MOQ
Free Shipping
S925 Sterling Silver Oval Zirconia Chain Ring For Women Minimalist Adjustable Geometric Link Finger Ring Jewelry Gift
S925 Sterling Silver Oval Zirconia Chain Ring For Women Minimalist Adjustable Geometric Link Finger Ring Jewelry Gift
like
Find Similar
Adjustable S925 sterling silver chain ring with oval-cut crystal and sliding bead - Adjustable Open / Platinum Plated White Zirconia
Adjustable S925 sterling silver chain ring featuring an oval pink gemstone solitaire - Adjustable Open / White Gold Pink Zirconia
Adjustable S925 sterling silver chain ring with oval green emerald gemstone - Adjustable Open / Platinum with Green Zircon
Adjustable S925 sterling silver chain ring with oval-cut moissanite stone - Adjustable Open / Gold Plated White Zirconia
+2
S925 Sterling Silver Oval Zirconia Chain Ring For Women Minimalist Adjustable Geometric Link Finger Ring Jewelry Gift
$9.69
Mix MOQ : 2
Free Shipping
S925 Sterling Silver Beaded Ring For Women Minimalist Adjustable Elastic Ring With Artificial Pearl Vintage Jewelry
S925 Sterling Silver Beaded Ring For Women Minimalist Adjustable Elastic Ring With Artificial Pearl Vintage Jewelry
like
Find Similar
Minimalist S925 sterling silver beaded rings featuring translucent moonstone gemstones - Adjustable Open / Style A (1JZ72-SG)
Minimalist S925 sterling silver beaded ring with polished metal bar and cream pearls - Adjustable Open / Style B (1JZ73-SG)
S925 Sterling Silver Beaded Ring For Women Minimalist Adjustable Elastic Ring With Artificial Pearl Vintage Jewelry
-11%
$10.20-11.20
No MOQ
Free Shipping
Fashion Gold Plated Copper Enamel Geometric Open Adjustable Ring Minimalist Color Block Finger Ring For Women Daily Jewelry
Fashion Gold Plated Copper Enamel Geometric Open Adjustable Ring Minimalist Color Block Finger Ring For Women Daily Jewelry
like
Find Similar
Fashionable gold-plated adjustable ring featuring red and white enamel geometric design - Adjustable Open / White + Red
Minimalist gold-plated adjustable ring featuring a sleek pink enamel rectangular top - Adjustable Open / Pink
Detail of adjustable gold-plated ring featuring geometric white enamel inlay - Adjustable Open / White
Detail of gold-plated open ring featuring a polished sky blue enamel inlay surface - Adjustable Open / Blue
+3
Fashion Gold Plated Copper Enamel Geometric Open Adjustable Ring Minimalist Color Block Finger Ring For Women Daily Jewelry
$2.02
No MOQ
Free Shipping
S925 Sterling Silver Mountain And Sea Couple Rings Adjustable Open Finger Rings For Lovers Minimalist Jewelry Gifts
S925 Sterling Silver Mountain And Sea Couple Rings Adjustable Open Finger Rings For Lovers Minimalist Jewelry Gifts
like
Find Similar
2 options
S925 Sterling Silver Mountain And Sea Couple Rings Adjustable Open Finger Rings For Lovers Minimalist Jewelry Gifts
$12.31-18.34
No MOQ
Free Shipping
Minimalist Titanium Steel Triple Interlocked Rings Multilayer Zirconia Inlaid Fashion Jewelry For Men And Women Couple Accessory
Minimalist Titanium Steel Triple Interlocked Rings Multilayer Zirconia Inlaid Fashion Jewelry For Men And Women Couple Accessory
like
Find Similar
Three-layer titanium steel ring with silver finish and pavé zircon stones on black background - Number 5 / Steel
Three-layer gold titanium steel ring with micro-pave crystals on black background - Number 5 / Gold
Three-layer rose gold titanium steel ring with sparkling pave cubic zirconia accents - Number 5 / Rose Gold
+12
Minimalist Titanium Steel Triple Interlocked Rings Multilayer Zirconia Inlaid Fashion Jewelry For Men And Women Couple Accessory
$3.14-3.41
No MOQ
Free Shipping
Hip Hop Men Stainless Steel Square Signet Ring With Pave Rhinestones Geometric Gold Silver Plated Fashion Street Jewelry Gift
Hip Hop Men Stainless Steel Square Signet Ring With Pave Rhinestones Geometric Gold Silver Plated Fashion Street Jewelry Gift
like
Find Similar
Silver square geometric double row diamond encrusted titanium steel ring in hip hop style - US 7 / Steel
Men's gold-plated titanium steel signet ring with double row pavé zircon stones - US 7 / Gold
+12
Hip Hop Men Stainless Steel Square Signet Ring With Pave Rhinestones Geometric Gold Silver Plated Fashion Street Jewelry Gift
$3.09-3.35
No MOQ
Free Shipping
925 Sterling Silver Pixel Heart Ring For Women Vintage Rhinestone Adjustable Opening Finger Ring Fashion Jewelry Accessory
925 Sterling Silver Pixel Heart Ring For Women Vintage Rhinestone Adjustable Opening Finger Ring Fashion Jewelry Accessory
like
Find Similar
Minimalist S925 sterling silver ring with pixelated heart and pink zircon in 45-degree view - Pink Pixel Heart Style (KDP1347)
925 Sterling Silver Pixel Heart Ring For Women Vintage Rhinestone Adjustable Opening Finger Ring Fashion Jewelry Accessory
$27.25
Mix MOQ : 2
Free Shipping
Hip Hop Men Stainless Steel Religious Ring Virgin Mary Signet Gold Silver Color Rhinestone Inlaid Gothic Punk Jewelry Gift
Hip Hop Men Stainless Steel Religious Ring Virgin Mary Signet Gold Silver Color Rhinestone Inlaid Gothic Punk Jewelry Gift
like
Find Similar
Gold plated hip hop ring featuring Virgin Mary relief with red, green and white crystals - US 7 / Gold
Religious Virgin Mary ring in stainless steel with colorful crystals and vintage relief - US 7 / Steel
+12
Hip Hop Men Stainless Steel Religious Ring Virgin Mary Signet Gold Silver Color Rhinestone Inlaid Gothic Punk Jewelry Gift
-4%
$2.62-2.87
No MOQ
Free Shipping
Geometric Stainless Steel Rings For Women Two Tone Gold Silver Contrast Hip Hop Star Wavy Minimalist Finger Jewelry
Geometric Stainless Steel Rings For Women Two Tone Gold Silver Contrast Hip Hop Star Wavy Minimalist Finger Jewelry
like
Find Similar
Two-tone stainless steel overlapping ring in gold and silver finish with size specs - Curved Overlapping Style (755)
Three-layer two-tone stainless steel wide ring in gold and silver matte finish - Three-layer Wide Band Style (1244)
Two-tone stainless steel spike ring with gold and silver finish and industrial style - Vertical Spike Double Ring Style (1605)
Three-layer wavy stainless steel ring with gold and silver contrast and size details - Three-layer Wavy Open Style (1554)
+2
Geometric Stainless Steel Rings For Women Two Tone Gold Silver Contrast Hip Hop Star Wavy Minimalist Finger Jewelry
$1.16
No MOQ
 · 
139 sold recently
Free Shipping
Elegant Butterfly Ring For Women Gold Plated Brass Zircon Inlaid Adjustable Opening Ring Trendy Hip Hop Jewelry Gift
Elegant Butterfly Ring For Women Gold Plated Brass Zircon Inlaid Adjustable Opening Ring Trendy Hip Hop Jewelry Gift
like
Find Similar
1 option
Elegant Butterfly Ring For Women Gold Plated Brass Zircon Inlaid Adjustable Opening Ring Trendy Hip Hop Jewelry Gift
-4%
$7.72
No MOQ
Free Shipping
Vintage Gothic Men Stainless Steel Skull Crossbones Ring Punk Hip Hop Biker Ring With Red Blue Rhinestone Eye Jewelry Gift
Vintage Gothic Men Stainless Steel Skull Crossbones Ring Punk Hip Hop Biker Ring With Red Blue Rhinestone Eye Jewelry Gift
like
Find Similar
Gothic punk skull and crossbones ring for men in silver finish with vintage texture - US 7 / Plain Style
Gothic punk skull ring for men with red gemstone eyes and vintage silver finish - US 7 / Red Rhinestone Eyes
Men's retro skull ring in silver finish with blue gemstones and crossbones - US 7 / Blue Rhinestone Eyes
+18
Vintage Gothic Men Stainless Steel Skull Crossbones Ring Punk Hip Hop Biker Ring With Red Blue Rhinestone Eye Jewelry Gift
$3.14-3.41
No MOQ
Free Shipping
Gothic Punk Coffin Skull Ring Alloy Skeleton Retro Halloween Jewelry For Men Women
Gothic Punk Coffin Skull Ring Alloy Skeleton Retro Halloween Jewelry For Men Women
like
Find Similar
Gothic punk gold skull ring featuring a red coffin shaped gemstone on a white background - US 6 / Gold Red
Gothic punk silver skull ring with red coffin stone in retro vampire style design - US 8 / Silver Red
+11
Gothic Punk Coffin Skull Ring Alloy Skeleton Retro Halloween Jewelry For Men Women
$0.77
No MOQ
 · 
200 sold recently
Free Shipping
925 Sterling Silver Hammered Open Ring For Women Minimalist Adjustable Finger Ring Elegant Handmade Jewelry Daily Gift
925 Sterling Silver Hammered Open Ring For Women Minimalist Adjustable Finger Ring Elegant Handmade Jewelry Daily Gift
like
Find Similar
Minimalist S925 sterling silver open ring with irregular hammered texture for women - Adjustable Open / White Gold
Adjustable golden hammered texture ring with a minimalist open design for women - Adjustable Open / Gold
925 Sterling Silver Hammered Open Ring For Women Minimalist Adjustable Finger Ring Elegant Handmade Jewelry Daily Gift
$25.67
Mix MOQ : 2
Free Shipping
Minimalist Stainless Steel Geometric Open Ring For Women Men Vintage Adjustable Wrap Finger Ring Gold Silver Rainbow Jewelry
Minimalist Stainless Steel Geometric Open Ring For Women Men Vintage Adjustable Wrap Finger Ring Gold Silver Rainbow Jewelry
like
Find Similar
Detail of overlapping wave design on a 1.7cm wide silver stainless steel ring - Steel
Macro detail of rainbow stainless steel geometric ring with adjustable double-layer design - Rainbow
Detail view of adjustable gold stainless steel ring showing 1.7cm diameter size info - Gold
Minimalist Stainless Steel Geometric Open Ring For Women Men Vintage Adjustable Wrap Finger Ring Gold Silver Rainbow Jewelry
$0.52-0.78
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel All-Seeing Eye Ring Men Punk Gothic Eye Of Providence Triangle Signet Ring Retro Silver Jewelry
Vintage Stainless Steel All-Seeing Eye Ring Men Punk Gothic Eye Of Providence Triangle Signet Ring Retro Silver Jewelry
like
Find Similar
4 options
Vintage Stainless Steel All-Seeing Eye Ring Men Punk Gothic Eye Of Providence Triangle Signet Ring Retro Silver Jewelry
-4%
$3.24
No MOQ
Free Shipping
925 Sterling Silver Open Ring For Women Minimalist Irregular Double Layer Adjustable Finger Ring Korean Style Jewelry Gift
925 Sterling Silver Open Ring For Women Minimalist Irregular Double Layer Adjustable Finger Ring Korean Style Jewelry Gift
like
Find Similar
2 options
925 Sterling Silver Open Ring For Women Minimalist Irregular Double Layer Adjustable Finger Ring Korean Style Jewelry Gift
$17.55
No MOQ
Free Shipping
Faceted Ceramic Ring Geometric Rhombic Cut Modern Minimalist Fashion Band For Men Women Couples Unisex Jewelry
Faceted Ceramic Ring Geometric Rhombic Cut Modern Minimalist Fashion Band For Men Women Couples Unisex Jewelry
like
Find Similar
Elegant white ceramic ring featuring a geometric diamond-cut textured faceted surface - US 5 / White
Polished black faceted ceramic ring with geometric diamond cut surface and comfort fit inner band - US 5 / Black
+14
Faceted Ceramic Ring Geometric Rhombic Cut Modern Minimalist Fashion Band For Men Women Couples Unisex Jewelry
$2.10
No MOQ
 · 
188 sold recently
Free Shipping
Retro Titanium Steel Ancient Egyptian Eye Of Horus Ankh Signet Ring For Men Punk Gothic Ethnic Pharaoh Finger Jewelry Accessory
Retro Titanium Steel Ancient Egyptian Eye Of Horus Ankh Signet Ring For Men Punk Gothic Ethnic Pharaoh Finger Jewelry Accessory
like
Find Similar
Vintage stainless steel Egyptian Horus Eye and Ankh ring with silver finish for men - US 7 / Steel
Vintage Egyptian Eye of Horus Ankh signet ring in silver and gold stainless steel - US 7 / Gold & Silver
+12
Retro Titanium Steel Ancient Egyptian Eye Of Horus Ankh Signet Ring For Men Punk Gothic Ethnic Pharaoh Finger Jewelry Accessory
$3.14-3.88
No MOQ
Free Shipping
925 Sterling Silver Beaded Ring For Women Minimalist Adjustable Open Geometric Finger Ring Vintage Korean Style Jewelry
925 Sterling Silver Beaded Ring For Women Minimalist Adjustable Open Geometric Finger Ring Vintage Korean Style Jewelry
like
Find Similar
Adjustable S925 sterling silver beaded ring featuring multifaceted metallic beads - Adjustable Open / Vintage Beaded Style (JZD079) / Silver
New925 Sterling Silver Beaded Ring For Women Minimalist Adjustable Open Geometric Finger Ring Vintage Korean Style Jewelry
-13%
$34.84
No MOQ
Free Shipping
Retro Ethnic Alloy Ring With Purple Gemstone And Blue Turquoise Style Beads Gold Plated Adjustable Jewelry Gift For Women
Retro Ethnic Alloy Ring With Purple Gemstone And Blue Turquoise Style Beads Gold Plated Adjustable Jewelry Gift For Women
like
Find Similar
Vintage style gold alloy wrap ring with turquoise beads and purple oval gemstones - US 5 / Gold
+6
Retro Ethnic Alloy Ring With Purple Gemstone And Blue Turquoise Style Beads Gold Plated Adjustable Jewelry Gift For Women
$0.86
No MOQ
 · 
1 reviews
Free Shipping
Vintage Feather Open Ring Titanium Steel Retro Oxidized Finish Men Women Jewelry Adjustable Band Indian Style Finger Accessories
Vintage Feather Open Ring Titanium Steel Retro Oxidized Finish Men Women Jewelry Adjustable Band Indian Style Finger Accessories
like
Find Similar
Retro oxidized silver feather ring in a vintage adjustable wrap design for men - US 7 / Steel Ring
Retro oxidized silver feather ring with gold center accent and adjustable open design - US 7 / Two-tone Ring
+10
Vintage Feather Open Ring Titanium Steel Retro Oxidized Finish Men Women Jewelry Adjustable Band Indian Style Finger Accessories
-5%
$3.24-3.48
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access