Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Minimalist Stainless Steel Ring Plain Polished Band Fashion Jewelry For Men And Women Stylish Stackable Unisex
Minimalist Stainless Steel Ring Plain Polished Band Fashion Jewelry For Men And Women Stylish Stackable Unisex
like
Find Similar
Sleek 3mm silver stainless steel band ring available in US sizes 5 to 11 for unisex - US 5 / Steel
Minimalist 3mm wide golden polished stainless steel ring band available in sizes 5 to 11 - US 5 / Gold
3mm minimalist rose gold stainless steel ring with polished surface for couples - US 5 / Rose Gold
Black 3mm matte finish stainless steel ring for men and women in sizes 5 to 11 - US 5 / Black
+38
Minimalist Stainless Steel Ring Plain Polished Band Fashion Jewelry For Men And Women Stylish Stackable Unisex
$0.29-0.46
No MOQ
 · 
258 sold recently
Free Shipping
Cat Animal Open Rings For Women Adjustable Alloy Geometric Minimalist Fashion Jewelry Accessories With Rhinestone
Cat Animal Open Rings For Women Adjustable Alloy Geometric Minimalist Fashion Jewelry Accessories With Rhinestone
like
Find Similar
Adjustable silver cat paw ring with pink heart crystal jewelry - Silver Pink Heart Cat Paw
Adjustable silver cat ring featuring a round pink strawberry quartz gemstone - Silver Fox Pink Stone
Rose gold cat paw adjustable open ring with pink heart gems and cute paw print design. - Rose Gold Cat Paw Ring
Silver adjustable open ring with cat ear design and white enamel detail for women - Silver White Cat Ear Style
+5
Cat Animal Open Rings For Women Adjustable Alloy Geometric Minimalist Fashion Jewelry Accessories With Rhinestone
$0.29-0.79
No MOQ
 · 
52 sold recently
Free Shipping
Vintage Bohemian Alloy Ring With Turquoise Oval Stone Antique Silver Open Adjustable Carved Finger Jewelry For Women
Vintage Bohemian Alloy Ring With Turquoise Oval Stone Antique Silver Open Adjustable Carved Finger Jewelry For Women
like
Find Similar
Vintage silver-tone wide band ring featuring a blue turquoise stone in a woven design - Adjustable Open / Royal Blue / Antique Silver
Vintage Bohemian Alloy Ring With Turquoise Oval Stone Antique Silver Open Adjustable Carved Finger Jewelry For Women
$1.02
No MOQ
 · 
342 sold recently
Free Shipping
Vintage Stainless Steel Signet Ring For Men Women Multi Color Rhinestone Faux Gemstone Polished Geometric Fashion Jewelry Ring
Vintage Stainless Steel Signet Ring For Men Women Multi Color Rhinestone Faux Gemstone Polished Geometric Fashion Jewelry Ring
like
Find Similar
Vintage stainless steel ring with green cat-eye gemstone and silver polished finish - US 7 / Silver Base Green Cat Eye
Polished stainless steel signet ring with a large oval-cut ruby gemstone on black surface - US 7 / Silver Base Red Glass Stone
Vintage stainless steel ring with a large grey-blue cat eye gemstone in oval shape - US 7 / Steel Base Gray Cat's Eye
Minimalist silver stainless steel ring featuring a large oval black gemstone cabochon - US 7 / Steel Base Black Onyx
+140
Vintage Stainless Steel Signet Ring For Men Women Multi Color Rhinestone Faux Gemstone Polished Geometric Fashion Jewelry Ring
$3.93-4.19
No MOQ
Free Shipping
Minimalist Stainless Steel Dome Ring For Women Men High Polished Plain Band Wedding Band Finger Jewelry Unisex Fashion Gift
Minimalist Stainless Steel Dome Ring For Women Men High Polished Plain Band Wedding Band Finger Jewelry Unisex Fashion Gift
like
Find Similar
116 options
Minimalist Stainless Steel Dome Ring For Women Men High Polished Plain Band Wedding Band Finger Jewelry Unisex Fashion Gift
-5%
$0.62-1.12
No MOQ
Free Shipping
Men Fist Skull Ring Stainless Steel Punk Rock Biker Vintage Gold Silver Two Tone Gothic Engraved Statement Jewelry
Men Fist Skull Ring Stainless Steel Punk Rock Biker Vintage Gold Silver Two Tone Gothic Engraved Statement Jewelry
like
Find Similar
Men's vintage titanium steel skull fist ring with gothic engraving in silver finish - US 7 / Steel
Vintage punk silver steel fist ring with gold KFW 1 engravings and skull detail - US 7 / Two-tone (Gold & Silver)
+12
Men Fist Skull Ring Stainless Steel Punk Rock Biker Vintage Gold Silver Two Tone Gothic Engraved Statement Jewelry
$3.09-3.35
No MOQ
 · 
37 sold recently
Free Shipping
Vintage 304 Stainless Steel Oval Ring Blank Adjustable 18K Gold Plated Minimalist Setting For DIY Jewelry Making Unisex
Vintage 304 Stainless Steel Oval Ring Blank Adjustable 18K Gold Plated Minimalist Setting For DIY Jewelry Making Unisex
like
Find Similar
Close-up of oval stainless steel ring base with braided texture and size dimensions - Silver
Detailed view of golden oval ring base with woven edges and precise size measurements - Gold
Vintage 304 Stainless Steel Oval Ring Blank Adjustable 18K Gold Plated Minimalist Setting For DIY Jewelry Making Unisex
$0.39-0.52
Mix MOQ : 2
 · 
12 views
Free Shipping
French Brushed Matte Open Ring Women Copper Gold Silver Plated Irregular Dome Geometric Minimalist Statement Finger Ring
French Brushed Matte Open Ring Women Copper Gold Silver Plated Irregular Dome Geometric Minimalist Statement Finger Ring
like
Find Similar
Minimalist matte gold dome ring with brushed metal texture and smooth inner finish - Gold
Macro detail of silver ring featuring brushed matte finish and smooth inner surface - Silver
French Brushed Matte Open Ring Women Copper Gold Silver Plated Irregular Dome Geometric Minimalist Statement Finger Ring
$3.27
No MOQ
Free Shipping
Nordic Viking Rune Stainless Steel Spinner Ring For Men Rotating Cuban Chain Anxiety Relief Band Punk Biker Jewelry Gift
Nordic Viking Rune Stainless Steel Spinner Ring For Men Rotating Cuban Chain Anxiety Relief Band Punk Biker Jewelry Gift
like
Find Similar
Norse Viking rune spinner ring with black rotatable chain in polished stainless steel - US 6 / Silver + Black
Nordic viking rune spinner ring with blue chain inlay in polished stainless steel finish - US 6 / Silver + Blue
Men's rotatable black stainless steel ring with blue chain and Nordic rune engravings - US 6 / Black + Blue
+21
Nordic Viking Rune Stainless Steel Spinner Ring For Men Rotating Cuban Chain Anxiety Relief Band Punk Biker Jewelry Gift
$2.10-2.36
No MOQ
Free Shipping
925 Sterling Silver Open Ring For Women Fashion Colorful Zirconia Inlaid Geometric Adjustable Finger Ring Jewelry Gift
925 Sterling Silver Open Ring For Women Fashion Colorful Zirconia Inlaid Geometric Adjustable Finger Ring Jewelry Gift
like
Find Similar
S925 sterling silver open ring with double-row colorful zircon stones in a polished finish - US 6 / Silver
Adjustable S925 silver ring with double-row colorful cubic zirconia in gold plating - US 6 / Gold
+4
925 Sterling Silver Open Ring For Women Fashion Colorful Zirconia Inlaid Geometric Adjustable Finger Ring Jewelry Gift
$20.96
No MOQ
Free Shipping
Stainless Steel Chain Linked Stackable Punk Finger Rings Gold Silver Plated Frosted Polished Fashion Jewelry For Women
Stainless Steel Chain Linked Stackable Punk Finger Rings Gold Silver Plated Frosted Polished Fashion Jewelry For Women
like
Find Similar
Three-piece set of gold stainless steel stackable chain rings with matte finish - US 6 / Gold
Three-piece silver stainless steel stacking ring set with link chains and matte finish - US 6 / Silver
+8
Stainless Steel Chain Linked Stackable Punk Finger Rings Gold Silver Plated Frosted Polished Fashion Jewelry For Women
$1.62-1.70
No MOQ
Free Shipping
Vintage Hammered Brass Wide Band Rings For Women Handmade Butterfly Bee Bat Leaf Flower Inlaid Rhinestone Statement Ring Jewelry Gift
Vintage Hammered Brass Wide Band Rings For Women Handmade Butterfly Bee Bat Leaf Flower Inlaid Rhinestone Statement Ring Jewelry Gift
like
Find Similar
Macro shot of wide textured silver ring with embossed gold bat detail and hammered finish - US 6 / Bat Relief Style (KYRA01490)
Macro detail of silver hammered ring featuring brass bee and iridescent opal stone - US 6 / Bee Pattern with Opal (KYRA01488)
Detailed macro view of vintage silver wide band ring with embossed flowers and golden bee - US 6 / Bee Flower Relief Style (KYRA01489)
Detailed view of a wide silver band ring with a golden leaf and green gemstone on wood - US 6 / Oak Leaf Pattern with Green Stone (KYRA01487)
+21
Vintage Hammered Brass Wide Band Rings For Women Handmade Butterfly Bee Bat Leaf Flower Inlaid Rhinestone Statement Ring Jewelry Gift
$2.04
No MOQ
 · 
186 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
925 Sterling Silver Purple Enamel Adjustable Open Ring For Women Trendy Claw Shape Zirconia Inlaid Individual Jewelry Ring
925 Sterling Silver Purple Enamel Adjustable Open Ring For Women Trendy Claw Shape Zirconia Inlaid Individual Jewelry Ring
like
Find Similar
S925 sterling silver open ring with lavender enamel and micro-pave white zircon stones - US Size 5 / Silver/Light Purple (JZ1840)
925 Sterling Silver Purple Enamel Adjustable Open Ring For Women Trendy Claw Shape Zirconia Inlaid Individual Jewelry Ring
-10%
$25.88
No MOQ
Free Shipping
Unisex Cuban Link Chain Ring Adjustable Open Alloy Finger Ring Punk Industrial Style Jewelry For Men Women Gold Silver Plated
Unisex Cuban Link Chain Ring Adjustable Open Alloy Finger Ring Punk Industrial Style Jewelry For Men Women Gold Silver Plated
like
Find Similar
Adjustable silver curb chain open ring with a classic minimalist link design for unisex wear - Adjustable Open / Silver
Adjustable golden Cuban link chain ring for men and women with minimalist open design - Adjustable Open / Gold
Unisex Cuban Link Chain Ring Adjustable Open Alloy Finger Ring Punk Industrial Style Jewelry For Men Women Gold Silver Plated
-4%
$0.62
Mix MOQ : 2
Minimalist Titanium Steel Stackable Ring For Men Women Polished High Gloss Geometric Simple Plain Band Jewelry Accessory
Minimalist Titanium Steel Stackable Ring For Men Women Polished High Gloss Geometric Simple Plain Band Jewelry Accessory
like
Find Similar
Polished 2.5mm gold titanium steel ring with a minimalist glossy mirror finish on white background - US 6 / Gold
Macro view of polished black stainless steel ring with a smooth mirror finish - US 6 / Black
Polished silver titanium steel cylinder ring with a smooth mirror finish and minimalist design - US 6 / Silver
+21
Minimalist Titanium Steel Stackable Ring For Men Women Polished High Gloss Geometric Simple Plain Band Jewelry Accessory
-5%
$0.70-0.75
No MOQ
Free Shipping
Leopard Head Ring Stainless Steel Red Gem Eye Punk Hip Hop Men Retro Animal Statement Jewelry
Leopard Head Ring Stainless Steel Red Gem Eye Punk Hip Hop Men Retro Animal Statement Jewelry
like
Find Similar
Retro hip hop cheetah titanium steel ring with red stone eyes and punk leopard head design - US 7 / Black
Vintage gold leopard head titanium steel ring with red stone eyes and black spots - US 7 / Gold
Vintage hip hop leopard ring in silver stainless steel with red zircon eyes - US 7 / Steel
+18
Leopard Head Ring Stainless Steel Red Gem Eye Punk Hip Hop Men Retro Animal Statement Jewelry
$3.41-3.80
Mix MOQ : 3
Free Shipping
Minimalist Plain Band Rings Titanium Steel High Polished Couple Rings For Wedding Engagement Jewelry Unisex Accessory
Minimalist Plain Band Rings Titanium Steel High Polished Couple Rings For Wedding Engagement Jewelry Unisex Accessory
like
Find Similar
Polished gold titanium steel ring with smooth mirror finish surface and minimalist style - US 5 / 4mm Gold
Detailed close-up of a wide polished gold titanium ring with a minimalist flat band design - US 5 / 6mm Gold
Polished black titanium steel ring showing glossy finish and rounded arc surface - US 5 / 4MM Black
Macro shot of polished silver titanium steel ring band showing smooth reflective surface - US 5 / 4MM Silver
+50
Minimalist Plain Band Rings Titanium Steel High Polished Couple Rings For Wedding Engagement Jewelry Unisex Accessory
$0.18-0.29
No MOQ
 · 
639 sold recently
Free Shipping
S925 Sterling Silver Korean Minimalist Grey Moonstone Beaded Rings For Women Elastic Adjustable Niche Design Finger Ring Fashion Jewelry Gift
S925 Sterling Silver Korean Minimalist Grey Moonstone Beaded Rings For Women Elastic Adjustable Niche Design Finger Ring Fashion Jewelry Gift
like
Find Similar
Three-piece S925 sterling silver beaded ring set with moonstone and gold accents - Adjustable Open / Grey Moonstone Beads With Gold Bead Accent (51JZ24)
S925 Sterling Silver Korean Minimalist Grey Moonstone Beaded Rings For Women Elastic Adjustable Niche Design Finger Ring Fashion Jewelry Gift
-6%
$7.34
No MOQ
Free Shipping
S925 Sterling Silver Antler Couple Pair Rings Adjustable Forest Style Deer Horn Open Ring With Cubic Zirconia Moonstone Valentine Gift
S925 Sterling Silver Antler Couple Pair Rings Adjustable Forest Style Deer Horn Open Ring With Cubic Zirconia Moonstone Valentine Gift
like
Find Similar
3 options
S925 Sterling Silver Antler Couple Pair Rings Adjustable Forest Style Deer Horn Open Ring With Cubic Zirconia Moonstone Valentine Gift
$18.60-28.82
No MOQ
Free Shipping
Vintage Gothic Punk Angel Wings Cross Alloy Ring Carved Antique Silver Adjustable Open Ring Personality Jewelry For Men Women
Vintage Gothic Punk Angel Wings Cross Alloy Ring Carved Antique Silver Adjustable Open Ring Personality Jewelry For Men Women
like
Find Similar
Gothic punk adjustable ring with silver cross wing relief design, height 26mm and weight 9g - Silver
Vintage Gothic Punk Angel Wings Cross Alloy Ring Carved Antique Silver Adjustable Open Ring Personality Jewelry For Men Women
$0.73
Mix MOQ : 2
Birthstone Stainless Steel Ring For Women Thin Gold Rose Gold Silver Rhinestone Inlaid Geometric Daily Jewelry Finger Ring
Birthstone Stainless Steel Ring For Women Thin Gold Rose Gold Silver Rhinestone Inlaid Geometric Daily Jewelry Finger Ring
like
Find Similar
Minimalist 14K gold stainless steel ring with 2mm round emerald birthstone detail - US5 / May-Emerald/Green / Gold
Minimalist stainless steel ring featuring 2mm purple amethyst and 14K gold plating finish - US5 / June-Amethyst/Purple / Gold
Gold stainless steel ring with 2mm yellow citrine stone, US sizes 5 6 7 available - US5 / November-Jonquil/Light Yellow / Gold
Minimalist 14K gold plated stainless steel ring with 2mm blue aquamarine stone - US5 / December-Aquamarine/Lake Blue / Gold
+75
Birthstone Stainless Steel Ring For Women Thin Gold Rose Gold Silver Rhinestone Inlaid Geometric Daily Jewelry Finger Ring
-5%
$0.64-0.84
No MOQ
 · 
11 views
Free Shipping
Minimalist 925 Sterling Silver Winding Knot Open Ring For Women Adjustable Multi Layer Stackable Fashion Finger Jewelry
Minimalist 925 Sterling Silver Winding Knot Open Ring For Women Adjustable Multi Layer Stackable Fashion Finger Jewelry
like
Find Similar
Polished S925 sterling silver multilayer knotted ring with adjustable open band - Open Size 14 (Adjustable 12-17) / White Gold
Minimalist double-layered knotted S925 silver ring with a golden finish and adjustable opening - Open Size 14 (Adjustable 12-17) / 18K Gold
Minimalist 925 Sterling Silver Winding Knot Open Ring For Women Adjustable Multi Layer Stackable Fashion Finger Jewelry
-15%
$56.35
Mix MOQ : 2
Free Shipping
S925 Sterling Silver Irregular Crushed Silver Open Ring For Women Minimalist Adjustable Statement Ring Finger Jewelry Gift
S925 Sterling Silver Irregular Crushed Silver Open Ring For Women Minimalist Adjustable Statement Ring Finger Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver irregular crushed silver ring with a polished round bead - Adjustable Open / Silver
S925 Sterling Silver Irregular Crushed Silver Open Ring For Women Minimalist Adjustable Statement Ring Finger Jewelry Gift
$13.12
No MOQ
Free Shipping
925 Sterling Silver Couples Rings Adjustable Zirconia Moonstone Inlaid Twist Simple Fashion Jewelry Lovers Valentine Gift
925 Sterling Silver Couples Rings Adjustable Zirconia Moonstone Inlaid Twist Simple Fashion Jewelry Lovers Valentine Gift
like
Find Similar
3 options
925 Sterling Silver Couples Rings Adjustable Zirconia Moonstone Inlaid Twist Simple Fashion Jewelry Lovers Valentine Gift
$14.41-16.24
No MOQ
Free Shipping
S925 Sterling Silver Twisted Rope Ring For Women Minimalist Stackable Finger Ring Electroplated Silver Twist Design Jewelry
S925 Sterling Silver Twisted Rope Ring For Women Minimalist Stackable Finger Ring Electroplated Silver Twist Design Jewelry
like
Find Similar
5 options
S925 Sterling Silver Twisted Rope Ring For Women Minimalist Stackable Finger Ring Electroplated Silver Twist Design Jewelry
-14%
$8.01
No MOQ
Free Shipping
Stainless Steel Skull Ring For Men Vintage Gothic Punk Geometric Polished Biker Finger Jewelry Band Halloween Party Gift
Stainless Steel Skull Ring For Men Vintage Gothic Punk Geometric Polished Biker Finger Jewelry Band Halloween Party Gift
like
Find Similar
27 options
Stainless Steel Skull Ring For Men Vintage Gothic Punk Geometric Polished Biker Finger Jewelry Band Halloween Party Gift
$2.98-3.24
No MOQ
Free Shipping
Vintage Heart Adjustable Stainless Steel Ring Smooth Heart Pattern Textured Band Gold Silver Rainbow Plated Finger Ring Women Jewelry
Vintage Heart Adjustable Stainless Steel Ring Smooth Heart Pattern Textured Band Gold Silver Rainbow Plated Finger Ring Women Jewelry
like
Find Similar
Close-up of heart-shaped silver ring with embossed woven texture and open adjustable band - Steel
Detail showing rainbow heart ring with triple beaded band and 1.7cm inner diameter size - Rainbow
Detail view of gold heart ring with hammered band texture and adjustable open design - Gold
Vintage Heart Adjustable Stainless Steel Ring Smooth Heart Pattern Textured Band Gold Silver Rainbow Plated Finger Ring Women Jewelry
$0.52-0.78
Mix MOQ : 2
Free Shipping
Minimalist Stainless Steel Open Ring For Women Men Geometric Spiral Rope Texture Adjustable Vintage Fashion Jewelry Finger Ring
Minimalist Stainless Steel Open Ring For Women Men Geometric Spiral Rope Texture Adjustable Vintage Fashion Jewelry Finger Ring
like
Find Similar
Detail view of adjustable stainless steel spiral rope ring with dimension labels - Silver
Detailed dimension guide for the gold braided open ring with size measurements in cm and inches - Gold
Detail of colorful iridescent stainless steel ring showing spiral texture and 1.1cm width - Colorful
Minimalist Stainless Steel Open Ring For Women Men Geometric Spiral Rope Texture Adjustable Vintage Fashion Jewelry Finger Ring
$0.52-0.78
No MOQ
Free Shipping
Vintage Nordic Viking Rune Celtic Knot Stainless Steel Ring For Men Retro Silver Gold Black Punk Jewelry Band Ring Gift
Vintage Nordic Viking Rune Celtic Knot Stainless Steel Ring For Men Retro Silver Gold Black Punk Jewelry Band Ring Gift
like
Find Similar
Vintage silver Viking ring with Nordic runes and Celtic knot pattern for men - Size 7 / Steel
Vintage silver Viking ring with Celtic knots and Rune inscriptions on steel - Size 7 / Antique Silver
Vintage Nordic Viking stainless steel ring with Celtic knot and Runic script carvings - Size 7 / Antique Gold
Black stainless steel Viking ring featuring Celtic knot carvings and Runic symbols for men - Size 7 / Black
+24
Vintage Nordic Viking Rune Celtic Knot Stainless Steel Ring For Men Retro Silver Gold Black Punk Jewelry Band Ring Gift
$2.10
No MOQ
Free Shipping
925 Sterling Silver Gold Plated Multicolor Zirconia Adjustable Open Ring Minimalist Geometric Fashion Jewelry Set For Women
925 Sterling Silver Gold Plated Multicolor Zirconia Adjustable Open Ring Minimalist Geometric Fashion Jewelry Set For Women
like
Find Similar
Luxurious S925 silver open ring with colorful zircon gemstones in a golden finish - Open Ring (10K Gold Plated + Lacquer)
Vintage S925 sterling silver gold-plated rainbow earrings with multi-color zircons - Earrings (10K Gold Plated + Lacquer)
Rainbow series S925 silver necklace with multicolored zircon pendant on a gold chain - Necklace (10K Gold Plated + Lacquer)
S925 sterling silver gold plated ring featuring five colorful geometric gemstones on white - Gold Plated Ring
925 Sterling Silver Gold Plated Multicolor Zirconia Adjustable Open Ring Minimalist Geometric Fashion Jewelry Set For Women
$23.16-33.64
No MOQ
Free Shipping
Elegant Gold Titanium Steel V-Shaped Rhinestone Ring For Women Men Fashion Minimalist Triple Row Inlaid Finger Ring Jewelry Accessory
Elegant Gold Titanium Steel V-Shaped Rhinestone Ring For Women Men Fashion Minimalist Triple Row Inlaid Finger Ring Jewelry Accessory
like
Find Similar
Men's fashion V-shaped gold plated titanium steel ring with three rows of pavé crystals - US 7 / Gold
+5
Elegant Gold Titanium Steel V-Shaped Rhinestone Ring For Women Men Fashion Minimalist Triple Row Inlaid Finger Ring Jewelry Accessory
-4%
$2.99
No MOQ
Free Shipping
Vintage Titanium Steel Cuban Chain Ring For Men Women Black Rhinestone Inlaid Antique Finish Retro Geometric Band Ring Jewelry
Vintage Titanium Steel Cuban Chain Ring For Men Women Black Rhinestone Inlaid Antique Finish Retro Geometric Band Ring Jewelry
like
Find Similar
Vintage steel signet ring with rectangle black onyx stone and chain link texture - US 7 / Steel
Men's hip-hop gold plated stainless steel ring with rectangular black gemstone and chain texture - US 7 / Gold
+12
Vintage Titanium Steel Cuban Chain Ring For Men Women Black Rhinestone Inlaid Antique Finish Retro Geometric Band Ring Jewelry
$3.35-3.62
No MOQ
 · 
23 sold recently
Free Shipping
Irregular Winding Knot Ring Gold Silver Plated Brass Minimalist Statement Rings For Women Party Adjustable Accessory
Irregular Winding Knot Ring Gold Silver Plated Brass Minimalist Statement Rings For Women Party Adjustable Accessory
like
Find Similar
Adjustable gold irregular knot ring with polished crossed lines for women and men - Adjustable Open / Gold
Irregular Winding Knot Ring Gold Silver Plated Brass Minimalist Statement Rings For Women Party Adjustable Accessory
$3.14
Mix MOQ : 2
Free Shipping
Fashion Stainless Steel Ring For Men Women Shell Inlay Drip Glue Minimalist Geometric Band Daily Commute Jewelry Ring Gift
Fashion Stainless Steel Ring For Men Women Shell Inlay Drip Glue Minimalist Geometric Band Daily Commute Jewelry Ring Gift
like
Find Similar
Fashionable men's silver ring with blue carbon fiber inlay on a clean white background - US 6 / Royal Blue Shell
Detailed view of polished stainless steel ring with rainbow shimmer inlay decoration - US 7 / Rainbow Shell
+14
Fashion Stainless Steel Ring For Men Women Shell Inlay Drip Glue Minimalist Geometric Band Daily Commute Jewelry Ring Gift
$0.42
No MOQ
 · 
126 sold recently
Vintage Feather Stainless Steel Ring Retro Men's Punk Style Band Ring Two-Tone Gold Silver Totem Ring For Men Jewelry
Vintage Feather Stainless Steel Ring Retro Men's Punk Style Band Ring Two-Tone Gold Silver Totem Ring For Men Jewelry
like
Find Similar
Retro feather embossed gold stainless steel ring with twisted rope texture and center groove - US 13 / Gold
Vintage Feather Stainless Steel Ring Retro Men's Punk Style Band Ring Two-Tone Gold Silver Totem Ring For Men Jewelry
$3.41
No MOQ
Free Shipping
Vintage Blue Zirconia Flower Open Ring Adjustable Purple Clover Cluster Ring Korean Style Fashion Alloy Ring For Women Daily Jewelry
Vintage Blue Zirconia Flower Open Ring Adjustable Purple Clover Cluster Ring Korean Style Fashion Alloy Ring For Women Daily Jewelry
like
Find Similar
Adjustable silver ring with vintage square cluster of blue and white zircon stones - Blue Zirconia Vintage Cluster Style (J0194) / Silver
Adjustable gold open ring featuring a four-leaf clover design with purple gemstone - Purple Clover Style (J0095) / Gold
Vintage Blue Zirconia Flower Open Ring Adjustable Purple Clover Cluster Ring Korean Style Fashion Alloy Ring For Women Daily Jewelry
-5%
$0.74-1.37
No MOQ
Free Shipping
Domineering Tiger Head Stainless Steel Ring For Men Retro Roaring Tiger Animal Band Vintage Gothic Punk Jewelry Gold Silver
Domineering Tiger Head Stainless Steel Ring For Men Retro Roaring Tiger Animal Band Vintage Gothic Punk Jewelry Gold Silver
like
Find Similar
Retro stainless steel tiger head ring for men with detailed roaring animal sculpture - US 7 / Steel
Gothic tiger head ring for men in gold stainless steel with realistic carving - US 7 / Gold
+12
Domineering Tiger Head Stainless Steel Ring For Men Retro Roaring Tiger Animal Band Vintage Gothic Punk Jewelry Gold Silver
$3.07
No MOQ
Free Shipping
Cartoon Ladybug Dots Cat Paw Time Gem Glass Open Ring For Women Kids Alloy Adjustable Fashion Jewelry Silver Finger Ring
Cartoon Ladybug Dots Cat Paw Time Gem Glass Open Ring For Women Kids Alloy Adjustable Fashion Jewelry Silver Finger Ring
like
Find Similar
Macro detail of the red ladybug pattern glass dome and silver adjustable ring band - Adjustable Open / Red Black Polka Dot Ladybug Style (XSWX4020-1)
Close-up of adjustable silver ladybug pattern ring on a rustic wooden background - Adjustable Open / Red Ladybug Dots Texture (XSWX4020-2)
Macro detail of silver adjustable ring with red and black polka dot ladybug cabochon gem - Adjustable Open / Mimetic Ladybug Texture (XSWX4020-3)
Adjustable silver ring with a glass cabochon featuring a bright green animal paw print - Adjustable Open / Fluorescent Green Paw Print Style (XSWX4020-4)
+2
Cartoon Ladybug Dots Cat Paw Time Gem Glass Open Ring For Women Kids Alloy Adjustable Fashion Jewelry Silver Finger Ring
$0.58
No MOQ
Vintage Cat Head Ring Titanium Steel Gothic Punk Distressed Animal Jewelry With Colored Gemstone Eyes For Men Women
Vintage Cat Head Ring Titanium Steel Gothic Punk Distressed Animal Jewelry With Colored Gemstone Eyes For Men Women
like
Find Similar
Detail of vintage owl ring featuring silver alloy texture and vibrant red eyes - US 6 / Steel Color Red Gemstone
Macro detail of vintage owl ring featuring retro silver finish and realistic yellow eyes - US 6 / Steel Base Yellow Gemstone
Vintage silver cat head ring featuring striking purple gemstone eyes on a white background - US 6 / Steel Color Purple Gemstone
Detailed view of vintage silver owl ring with blue gemstone eyes and textured engraving - US 6 / Steel Color Blue Gemstone
+26
Vintage Cat Head Ring Titanium Steel Gothic Punk Distressed Animal Jewelry With Colored Gemstone Eyes For Men Women
-4%
$2.99
Mix MOQ : 3
 · 
15 sold recently
Free Shipping
Minimalist Alloy Star Moon Open Ring For Women Adjustable Fashion Finger Ring Gold Silver Rose Gold Plated Jewelry
Minimalist Alloy Star Moon Open Ring For Women Adjustable Fashion Finger Ring Gold Silver Rose Gold Plated Jewelry
like
Find Similar
Polished silver star and moon adjustable open ring for women on a white background - Adjustable Open / Silver
Adjustable gold star and moon open ring with a polished finish on white background - Adjustable Open / Gold
Adjustable gold star and moon open ring with a minimalist polished finish for women - Adjustable Open / Rose Gold
Minimalist Alloy Star Moon Open Ring For Women Adjustable Fashion Finger Ring Gold Silver Rose Gold Plated Jewelry
-4%
$0.62
Mix MOQ : 2
Free Shipping
925 Sterling Silver Open Ring For Women Colorful Zirconia Inlaid Irregular Wave Adjustable Minimalist Fashion Ring Jewelry
925 Sterling Silver Open Ring For Women Colorful Zirconia Inlaid Irregular Wave Adjustable Minimalist Fashion Ring Jewelry
like
Find Similar
S925 sterling silver open ring with colorful zircon stones in a matte brushed finish - Size 13 (Adjustable) / Silver
925 Sterling Silver Open Ring For Women Colorful Zirconia Inlaid Irregular Wave Adjustable Minimalist Fashion Ring Jewelry
-19%
$18.49
No MOQ
Free Shipping
Vintage Punk Stainless Steel Hollow Leaf Cross Open Adjustable Ring For Men Women Exaggerated Gothic Rock Finger Jewelry Gift
Vintage Punk Stainless Steel Hollow Leaf Cross Open Adjustable Ring For Men Women Exaggerated Gothic Rock Finger Jewelry Gift
like
Find Similar
10 options
Vintage Punk Stainless Steel Hollow Leaf Cross Open Adjustable Ring For Men Women Exaggerated Gothic Rock Finger Jewelry Gift
-5%
$3.14-3.43
No MOQ
Free Shipping
S925 Sterling Silver Beaded Ring For Women Korean Sweet Cool Vintage Geometric Stackable Heart Star Charm Finger Jewelry
S925 Sterling Silver Beaded Ring For Women Korean Sweet Cool Vintage Geometric Stackable Heart Star Charm Finger Jewelry
like
Find Similar
Detail view of silver beaded elastic bracelet with heart pendant on a gift card - Heart Style
Close-up of S925 sterling silver beaded ring with a star engraved candy charm - Candy Style
Detailed macro view of S925 sterling silver beaded ring with heart engraved square pendant - Cube Style
Detailed close-up of S925 sterling silver beaded ring with gourd and disk charms - Gourd Style
S925 Sterling Silver Beaded Ring For Women Korean Sweet Cool Vintage Geometric Stackable Heart Star Charm Finger Jewelry
$15.93-20.49
No MOQ
Free Shipping
Vintage S925 Sterling Silver Feather Ring Minimalist Adjustable Opening Ring For Women Bohemian Style Party Jewelry Gift Accessory
Vintage S925 Sterling Silver Feather Ring Minimalist Adjustable Opening Ring For Women Bohemian Style Party Jewelry Gift Accessory
like
Find Similar
Detail view of adjustable silver feather ring featuring delicate textured wing patterns - Silver
NewVintage S925 Sterling Silver Feather Ring Minimalist Adjustable Opening Ring For Women Bohemian Style Party Jewelry Gift Accessory
$39.09
No MOQ
Free Shipping
Vintage Stainless Steel Celtic Cross Ring For Men Viking Nordic Knot Band Ring Retro Ethnic Style Jewelry Gift For Unisex
Vintage Stainless Steel Celtic Cross Ring For Men Viking Nordic Knot Band Ring Retro Ethnic Style Jewelry Gift For Unisex
like
Find Similar
Two-tone silver and gold Celtic Cross signet ring in stainless steel for men - US 7 / Gold
Men's vintage viking stainless steel ring with celtic knot and cross pattern design - US 7 / Steel
+12
Vintage Stainless Steel Celtic Cross Ring For Men Viking Nordic Knot Band Ring Retro Ethnic Style Jewelry Gift For Unisex
$3.35-3.80
No MOQ
Free Shipping
Titanium Steel Rhinestone Ring For Women Eternity Band Inlaid Rhinestones Fashion Minimalist Wedding Party Finger Jewelry
Titanium Steel Rhinestone Ring For Women Eternity Band Inlaid Rhinestones Fashion Minimalist Wedding Party Finger Jewelry
like
Find Similar
Rose gold stainless steel ring featuring a row of sparkling crystals in a half-eternity band - US 6 / Half Row Rhinestone (18-D-1) / Rose Gold
Polished silver titanium steel eternity ring with shimmering pavé cubic zirconia - US 6 / Half Row Rhinestones (18-D-2) / Black
Elegant silver stainless steel eternity ring with shimmering cubic zirconia crystals - US 6 / Half Row Rhinestones (18-D-3) / Steel
Rainbow gradient titanium steel ring featuring a row of sparkling cubic zirconia stones - US 6 / Half Row Rhinestones (18-D-4) / Colorful
+191
Titanium Steel Rhinestone Ring For Women Eternity Band Inlaid Rhinestones Fashion Minimalist Wedding Party Finger Jewelry
$0.26-0.73
No MOQ
Free Shipping
Vintage Freemasonry Stainless Steel Ring Glow In The Dark Luminous Band Masonic G Sign Fashion Jewelry Unisex Finger Ring
Vintage Freemasonry Stainless Steel Ring Glow In The Dark Luminous Band Masonic G Sign Fashion Jewelry Unisex Finger Ring
like
Find Similar
Men's titanium steel Masonic ring with luminous inner band and brushed silver finish - US 6 / Gold
Men's titanium steel Freemasonry ring with luminous brushed finish and silver glow - US 6 / Silver
+14
Vintage Freemasonry Stainless Steel Ring Glow In The Dark Luminous Band Masonic G Sign Fashion Jewelry Unisex Finger Ring
$0.65
No MOQ
Free Shipping
Elegant Titanium Steel Artificial Pearl Ring For Women Minimalist Geometric Gold Silver Plated Thin Band Finger Ring Jewelry
Elegant Titanium Steel Artificial Pearl Ring For Women Minimalist Geometric Gold Silver Plated Thin Band Finger Ring Jewelry
like
Find Similar
Elegant silver titanium steel ring with a classic white pearl on a black mirror surface - US 6 / Steel
Elegant minimalist gold titanium steel ring with a small white pearl on black background - US 6 / Gold
+6
Elegant Titanium Steel Artificial Pearl Ring For Women Minimalist Geometric Gold Silver Plated Thin Band Finger Ring Jewelry
$3.67-3.93
No MOQ
Free Shipping
Vintage Gothic Skull Ring For Men Stainless Steel Punk Rock Biker Band Ring Carved Skeleton Heavy Metal Jewelry Gift
Vintage Gothic Skull Ring For Men Stainless Steel Punk Rock Biker Band Ring Carved Skeleton Heavy Metal Jewelry Gift
like
Find Similar
6 options
Vintage Gothic Skull Ring For Men Stainless Steel Punk Rock Biker Band Ring Carved Skeleton Heavy Metal Jewelry Gift
-4%
$2.49
No MOQ
Free Shipping
Vintage Stainless Steel Ring For Men Women Sun Moon Star Relief Celestial Mystical Bohemian Band Ring Fashion Couple Jewelry
Vintage Stainless Steel Ring For Men Women Sun Moon Star Relief Celestial Mystical Bohemian Band Ring Fashion Couple Jewelry
like
Find Similar
Vintage sun moon and star celestial embossed titanium steel ring with silver finish - US 6 / Steel
Retro stainless steel sun moon and star engraved ring with celestial relief patterns - US 6 / Steel Black
+14
Vintage Stainless Steel Ring For Men Women Sun Moon Star Relief Celestial Mystical Bohemian Band Ring Fashion Couple Jewelry
-4%
$3.24
No MOQ
Free Shipping
Minimalist Stainless Steel Heart Charm Open Ring For Women Gold Silver Plated Adjustable Waterproof Fashion Jewelry Gift
Minimalist Stainless Steel Heart Charm Open Ring For Women Gold Silver Plated Adjustable Waterproof Fashion Jewelry Gift
like
Find Similar
Golden stainless steel wide ring featuring embossed heart pattern and a heart charm pendant - Gold Style 1 (JDR0312002-6)
Golden wide heart ring in stainless steel with charms and waterproof features - Gold Style 2 (JDR0312002-7)
18k gold plated wide stainless steel ring with heart patterns and dangling heart charm - Gold Style 3 (JDR0312002-8)
Golden stainless steel heart ring with precise dimensions and hypoallergenic properties - Gold Solid Style (JDR0312001)
+2
Minimalist Stainless Steel Heart Charm Open Ring For Women Gold Silver Plated Adjustable Waterproof Fashion Jewelry Gift
$5.11-6.68
No MOQ
Free Shipping
Skull Ring Copper Cubic Zirconia Colorful Round Stone Gothic Punk Style Jewelry For Women Men Halloween Fashion
Skull Ring Copper Cubic Zirconia Colorful Round Stone Gothic Punk Style Jewelry For Women Men Halloween Fashion
like
Find Similar
Detail of gothic skull ring with pink round gemstone and purple eyes on black band - US 7 / Pink
Detailed shot of black gothic skull ring featuring a red crown-set zircon stone - US 7 / Red
Gothic black skull ring for women featuring a large purple round gemstone and dark metal - US 7 / Purple
Close-up of black plated skull ring with a large green zircon and six-prong setting - US 7 / Green
+21
Skull Ring Copper Cubic Zirconia Colorful Round Stone Gothic Punk Style Jewelry For Women Men Halloween Fashion
-5%
$1.21
No MOQ
 · 
243 sold recently
Free Shipping
925 Sterling Silver Bowknot Couple Rings For Women Men Fashion Luminous Adjustable Open Rings Valentine's Day Jewelry Gift
925 Sterling Silver Bowknot Couple Rings For Women Men Fashion Luminous Adjustable Open Rings Valentine's Day Jewelry Gift
like
Find Similar
Luminous S925 sterling silver bow knot couple rings set with adjustable open design - Adjustable Open / Men and Women Styles / Silver with Luminous Light Blue
S925 sterling silver ring featuring a blue geometric diamond pattern and silver finish - Adjustable Open / Male Style / Silver with Luminous Light Blue Geometric
Adjustable S925 sterling silver ring with a delicate light blue bow design - Adjustable Open / Female Style / Silver with Luminous Light Blue Bowknot
925 Sterling Silver Bowknot Couple Rings For Women Men Fashion Luminous Adjustable Open Rings Valentine's Day Jewelry Gift
-14%
$7.86-19.65
No MOQ
Free Shipping
S925 Sterling Silver Irregular Twisted Line Zirconia Ring For Women Korean INS Style Adjustable Open Finger Ring Jewelry
S925 Sterling Silver Irregular Twisted Line Zirconia Ring For Women Korean INS Style Adjustable Open Finger Ring Jewelry
like
Find Similar
Irregular twisted S925 sterling silver ring featuring a round zircon stone inlay - Size 13 (Adjustable) / White Stone
Minimalist S925 sterling silver irregular ring with yellow round zircon in silver finish - Size 13 (Adjustable) / Yellow Stone
Irregular twisted S925 silver ring with a round yellow-green zircon stone - Size 13 (Adjustable) / Olive Green
S925 Sterling Silver Irregular Twisted Line Zirconia Ring For Women Korean INS Style Adjustable Open Finger Ring Jewelry
-14%
$14.67
No MOQ
Free Shipping
Retro Horus Eye Scorpion Totem Titanium Steel Ring For Men Vintage Religious Hip Hop Punk Biker Signet Ring Fashion Jewelry
Retro Horus Eye Scorpion Totem Titanium Steel Ring For Men Vintage Religious Hip Hop Punk Biker Signet Ring Fashion Jewelry
like
Find Similar
Vintage hip hop ring for men featuring a gold scorpion totem in stainless steel - US 7 / Black Gold Silver
+5
NewRetro Horus Eye Scorpion Totem Titanium Steel Ring For Men Vintage Religious Hip Hop Punk Biker Signet Ring Fashion Jewelry
$3.67
No MOQ
Free Shipping
Fashion 304 Stainless Steel Three-leaf Flower Open Ring Minimalist Radiating Texture Adjustable Finger Ring For Women Jewelry Gift
Fashion 304 Stainless Steel Three-leaf Flower Open Ring Minimalist Radiating Texture Adjustable Finger Ring For Women Jewelry Gift
like
Find Similar
Detailed view of 304 stainless steel floral ring with dimension markings and adjustable band - Silver (J795-S)
Close-up of gold 304 stainless steel clover ring with detailed 2.3cm flower and size labels - Gold (J795-G)
Fashion 304 Stainless Steel Three-leaf Flower Open Ring Minimalist Radiating Texture Adjustable Finger Ring For Women Jewelry Gift
$0.52-0.78
Mix MOQ : 2
French Cute Girly Bowknot Heart Zinc Alloy Ring Electroplated Red Enamel Rhinestone Adjustable Fashion Ring For Women Jewelry Gift
French Cute Girly Bowknot Heart Zinc Alloy Ring Electroplated Red Enamel Rhinestone Adjustable Fashion Ring For Women Jewelry Gift
like
Find Similar
French style bow and heart ring with a blue gemstone on a twisted silver band - Heart Twist Ring
Detail of vintage silver ring with gold cross relief and lucky engraving on band - Cross Twist Ring
Detail of silver heart ring with white enamel and red bow on a reflective surface - Enamel Heart Ring
French style silver adjustable ring with a light blue oval gemstone for women - Gemstone Ring
+27
French Cute Girly Bowknot Heart Zinc Alloy Ring Electroplated Red Enamel Rhinestone Adjustable Fashion Ring For Women Jewelry Gift
$0.24-0.67
No MOQ
 · 
306 sold recently
Free Shipping
Minimalist Titanium Steel Signet Ring For Women Men Gold Silver Black Plain Round Heart Square Geometric Statement Finger Ring
Minimalist Titanium Steel Signet Ring For Women Men Gold Silver Black Plain Round Heart Square Geometric Statement Finger Ring
like
Find Similar
Polished 18K gold-plated stainless steel heart-shaped signet ring for men - US 6 / Heart Style (13-C-8) / Gold
Minimalist stainless steel signet ring with a polished deep black finish for women - US 6 / Minimalist Signet Style (13-C-7) / Black
Polished silver stainless steel signet ring with a minimalist heart-shaped top surface - US 6 / Heart Style (13-C-9) / Steel
Minimalist square signet ring in silver stainless steel, polished finish with 18x15mm top - US 6 / Square Signet Style (13-B-7) / Steel
+213
Minimalist Titanium Steel Signet Ring For Women Men Gold Silver Black Plain Round Heart Square Geometric Statement Finger Ring
$1.02-1.40
No MOQ
 · 
10 views
Free Shipping
Punk Rings Alloy Adjustable Open Vintage Gothic Dragon Claw Octopus Skeleton Animal Motif For Men Women
Punk Rings Alloy Adjustable Open Vintage Gothic Dragon Claw Octopus Skeleton Animal Motif For Men Women
like
Find Similar
Adjustable silver octopus tentacle ring with vintage texture and detailed suckers - Octopus Tentacle 2
Punk style dragon claw ring in black and gold finish with a round pink gemstone inlay - Paw
Adjustable dragon claw ring in silver punk style for men and women on white background - Style 1
Adjustable dragon claw ring in vintage punk style with antique silver finish - Style 2
+15
Punk Rings Alloy Adjustable Open Vintage Gothic Dragon Claw Octopus Skeleton Animal Motif For Men Women
$0.20-0.33
No MOQ
 · 
133 sold recently
Stainless Steel Rings For Women Non Fading Gold Silver Minimalist Geometric Bamboo Knot Snake Rose Jewelry
Stainless Steel Rings For Women Non Fading Gold Silver Minimalist Geometric Bamboo Knot Snake Rose Jewelry
like
Find Similar
Golden titanium steel organic knot ring with 21mm height and 4mm width minimalist style - US 6 / Teardrop Bean Style / Gold
Golden titanium steel open ring featuring two polished 12mm metal beads in a sleek design - US 6 / Double Ball Open Style / Gold
Minimalist gold knot-style stainless steel ring with 18mm diameter and 7mm band width - US 6 / T-Bar Buckle / Gold
Sleek silver toggle knot ring in stainless steel with detailed dimensions and 18mm diameter - US 6 / T-Bar Buckle / Silver
+68
Stainless Steel Rings For Women Non Fading Gold Silver Minimalist Geometric Bamboo Knot Snake Rose Jewelry
$2.62-2.88
No MOQ
 · 
230 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access