Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Minimalist Stainless Steel Rose Gold Plated Stackable Ring For Women Slim Enamel Drip Oil Band Finger Ring Jewelry Gift
Minimalist Stainless Steel Rose Gold Plated Stackable Ring For Women Slim Enamel Drip Oil Band Finger Ring Jewelry Gift
like
Find Similar
Minimalist 1mm rose gold titanium ring with red enamel inlay for women stackable style - Size 9 / Red
Minimalist Stainless Steel Rose Gold Plated Stackable Ring For Women Slim Enamel Drip Oil Band Finger Ring Jewelry Gift
$1.05
No MOQ
Free Shipping
Vintage Stainless Steel Snake Ring For Women Personality Gold Rose Gold Silver Plated Polished Minimalist Animal Finger Ring Jewelry
Vintage Stainless Steel Snake Ring For Women Personality Gold Rose Gold Silver Plated Polished Minimalist Animal Finger Ring Jewelry
like
Find Similar
Detailed view of snake-shaped stainless steel ring with polished rose gold finish - US 7 / Gold
Detailed close-up of rose gold snake-shaped ring with polished mirror finish surface - US 7 / Rose Gold
+4
Vintage Stainless Steel Snake Ring For Women Personality Gold Rose Gold Silver Plated Polished Minimalist Animal Finger Ring Jewelry
$1.06
No MOQ
Free Shipping
Vintage Titanium Stainless Steel Hollow Oval Rhinestone Ring For Women Retro Artistic Spiral Scroll Pattern Plated Jewelry
Vintage Titanium Stainless Steel Hollow Oval Rhinestone Ring For Women Retro Artistic Spiral Scroll Pattern Plated Jewelry
like
Find Similar
Vintage stainless steel ring with large oval black onyx stone and engraved details - US 6 / Steel
Retro hollow gold steel ring featuring a large oval pink gemstone and filigree details - US 6 / Gold
+8
Vintage Titanium Stainless Steel Hollow Oval Rhinestone Ring For Women Retro Artistic Spiral Scroll Pattern Plated Jewelry
$3.67-4.19
No MOQ
Free Shipping
Hip Hop Men Titanium Steel Gold Plated Religious Jesus Portrait Seal Ring Vintage Praying Hands Letter Carved Jewelry
Hip Hop Men Titanium Steel Gold Plated Religious Jesus Portrait Seal Ring Vintage Praying Hands Letter Carved Jewelry
like
Find Similar
Hip hop style gold plated stainless steel signet ring with religious relief and prayer hands - US 7 / Gold
+6
Hip Hop Men Titanium Steel Gold Plated Religious Jesus Portrait Seal Ring Vintage Praying Hands Letter Carved Jewelry
$3.14
No MOQ
Free Shipping
Vintage Titanium Steel Devil Eye Ring For Men Women Antique Distressed Finish Gothic Punk Fashion Jewelry Band Finger Ring
Vintage Titanium Steel Devil Eye Ring For Men Women Antique Distressed Finish Gothic Punk Fashion Jewelry Band Finger Ring
like
Find Similar
Vintage evil eye band ring in distressed silver finish for punk and gothic styles - US 6 / Antique Silver Devil Eye
Vintage style gold titanium steel ring with evil eye pattern engravings for men and women - US 6 / Antique Bronze Devil Eye
+14
Vintage Titanium Steel Devil Eye Ring For Men Women Antique Distressed Finish Gothic Punk Fashion Jewelry Band Finger Ring
$0.73-0.92
No MOQ
Free Shipping
Vintage Hammered Brass Wide Band Rings For Women Handmade Butterfly Bee Bat Leaf Flower Inlaid Rhinestone Statement Ring Jewelry Gift
Vintage Hammered Brass Wide Band Rings For Women Handmade Butterfly Bee Bat Leaf Flower Inlaid Rhinestone Statement Ring Jewelry Gift
like
Find Similar
Macro shot of wide textured silver ring with embossed gold bat detail and hammered finish - US 6 / Bat Relief Style (KYRA01490)
Macro detail of silver hammered ring featuring brass bee and iridescent opal stone - US 6 / Bee Pattern with Opal (KYRA01488)
Detailed macro view of vintage silver wide band ring with embossed flowers and golden bee - US 6 / Bee Flower Relief Style (KYRA01489)
Detailed view of a wide silver band ring with a golden leaf and green gemstone on wood - US 6 / Oak Leaf Pattern with Green Stone (KYRA01487)
+21
Vintage Hammered Brass Wide Band Rings For Women Handmade Butterfly Bee Bat Leaf Flower Inlaid Rhinestone Statement Ring Jewelry Gift
$2.04
No MOQ
 · 
186 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Vintage Titanium Steel Tree Bark Texture Ring For Men Women Retro Industrial Distressed Polished Wide Band Punk Jewelry
Vintage Titanium Steel Tree Bark Texture Ring For Men Women Retro Industrial Distressed Polished Wide Band Punk Jewelry
like
Find Similar
Mens vintage titanium steel ring with textured tree bark finish and oxidized silver surface - US 7 / Antique Silver
+5
Vintage Titanium Steel Tree Bark Texture Ring For Men Women Retro Industrial Distressed Polished Wide Band Punk Jewelry
$3.41
No MOQ
Free Shipping
Vintage Braided Wheat Ear Titanium Steel Ring Unisex Retro Oxidized Twisted Rope Jewelry Accessory For Men Women
Vintage Braided Wheat Ear Titanium Steel Ring Unisex Retro Oxidized Twisted Rope Jewelry Accessory For Men Women
like
Find Similar
Retro stainless steel braided wheat ring with oxidized finish and industrial style - US 7 / Antique Silver
+4
Vintage Braided Wheat Ear Titanium Steel Ring Unisex Retro Oxidized Twisted Rope Jewelry Accessory For Men Women
$3.41
No MOQ
Free Shipping
Fashion Rings For Women Alloy Butterfly Heart Zircon Adjustable Open Ring Ins Style Light Luxury Jewelry Gift
Fashion Rings For Women Alloy Butterfly Heart Zircon Adjustable Open Ring Ins Style Light Luxury Jewelry Gift
like
Find Similar
Elegant gold butterfly open ring with detailed hollow wings and adjustable band - Hollow Butterfly Open Ring / KC Gold (01KC金5737)
Minimalist silver V-shaped ring with a sparkling zircon in a four-prong setting - V-shape Solitaire Minimalist Ring / Silver (01白KA-1103)
Minimalist silver double-layered open ring with sparkling pavé stones and 2.0cm diameter - Double Layer Pave Open Ring / Silver (02白KWG-1456)
Minimalist silver interlocking heart ring with 1.9cm diameter on beige background - Triple Hollow Heart Ring / Silver (02白Kx342)
+9
Fashion Rings For Women Alloy Butterfly Heart Zircon Adjustable Open Ring Ins Style Light Luxury Jewelry Gift
-9%
$0.09-0.26
No MOQ
 · 
57 sold recently
Free Shipping
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
like
Find Similar
Detailed view of 18k gold titanium steel ring featuring celestial planet motifs and rhinestones - Star Moon Planet Style (JDR0205002)
Gold stainless steel ring with pink palm tree motif and micro-set zircon stones - Palm Tree Style (JDR0205004)
Golden octagonal stainless steel ring with cactus enamel and sparkling side crystals - Desert Cactus Style (JDR0205005)
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
$5.11
No MOQ
 · 
15 views
Free Shipping
Hip Hop Stainless Steel Smiley Face Ring For Men Women Vintage Enamel Yellow Silver Color Polished Signet Band Ring Jewelry
Hip Hop Stainless Steel Smiley Face Ring For Men Women Vintage Enamel Yellow Silver Color Polished Signet Band Ring Jewelry
like
Find Similar
Polished silver stainless steel ring with a bright yellow enamel smiley face design - US 7 / Yellow
Hip hop silver stainless steel ring with black smiley face and beaded edge detail - US 7 / Steel
+8
NewHip Hop Stainless Steel Smiley Face Ring For Men Women Vintage Enamel Yellow Silver Color Polished Signet Band Ring Jewelry
-5%
$3.48
No MOQ
Free Shipping
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
like
Find Similar
Detailed view of wide gold ring featuring alternating polished and frosted textures - US 7 / Gold
Detail of silver men's ring with a frosted texture band and polished steel edges - US 7 / Silver
Detail view of black stainless steel ring with polished edges and matte meteorite texture - US 7 / Black
+15
Titanium Steel Frosted Sandblasted Ring For Men Women Grooved Edge Polished Wedding Band Minimalist Fashion Jewelry
-4%
$0.61-0.70
No MOQ
 · 
41 sold recently
Free Shipping
Vintage Titanium Steel Signet Ring For Men Women Square Artificial Turquoise Inlay Geometric Band Ring Punk Jewelry
Vintage Titanium Steel Signet Ring For Men Women Square Artificial Turquoise Inlay Geometric Band Ring Punk Jewelry
like
Find Similar
Polished silver titanium steel ring featuring a square turquoise stone on white background - US 7 / Silver Color (Turquoise)
Titanium steel turquoise ring with a square blue stone in a golden minimalist finish - US 7 / Gold Color (Turquoise)
Matte black titanium steel ring featuring a square turquoise stone inlay for men and women - US 7 / Black Color (Turquoise)
+15
Vintage Titanium Steel Signet Ring For Men Women Square Artificial Turquoise Inlay Geometric Band Ring Punk Jewelry
-5%
$3.73-3.98
No MOQ
Free Shipping
Vintage Stainless Steel Eye of Horus Ring For Men Punk Rock Ancient Egypt Symbol Embossed Band Ring Fashion Jewelry Gift
Vintage Stainless Steel Eye of Horus Ring For Men Punk Rock Ancient Egypt Symbol Embossed Band Ring Fashion Jewelry Gift
like
Find Similar
5 options
NewVintage Stainless Steel Eye of Horus Ring For Men Punk Rock Ancient Egypt Symbol Embossed Band Ring Fashion Jewelry Gift
$2.88
No MOQ
Free Shipping
Vintage Palace Titanium Steel Ring For Men Square Cut Rhinestone Inlaid Gold Plated Fashion Signet Ring Men Jewelry
Vintage Palace Titanium Steel Ring For Men Square Cut Rhinestone Inlaid Gold Plated Fashion Signet Ring Men Jewelry
like
Find Similar
Vintage palace style titanium steel ring featuring a large faceted red gemstone inlay - US 7 / Gold / Red
Vintage gold plated stainless steel signet ring featuring a large emerald green gemstone - US 7 / Gold / Green
Vintage gold wide band ring with square multifaceted blue sapphire gemstone in a minimalist style - US 7 / Gold Base Blue Stone
Retro court style gold titanium steel ring with a square blue goldstone cat eye gem - US 7 / Gold Base Purple Rhinestone
+26
Vintage Palace Titanium Steel Ring For Men Square Cut Rhinestone Inlaid Gold Plated Fashion Signet Ring Men Jewelry
-4%
$4.98
No MOQ
Free Shipping
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
like
Find Similar
Macro shot of 8mm brushed silver ring with vibrant blue center groove and polished interior - US 7 / Silver & Blue
Detail of 8mm wide men's ring with matte black finish and polished blue inner band - US 7 / Black and Blue
8mm black brushed stainless steel ring with a polished gold center band for men - US 7 / Black and Gold
+21
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
$0.52-1.02
No MOQ
 · 
35 sold recently
Free Shipping
Vintage Stainless Steel Feather Open Ring Adjustable Leaf Texture Band Ring For Women Men Minimalist Fashion Jewelry Gift
Vintage Stainless Steel Feather Open Ring Adjustable Leaf Texture Band Ring For Women Men Minimalist Fashion Jewelry Gift
like
Find Similar
Detail view of double feather stainless steel ring with 1.7cm adjustable inner diameter - Steel
Macro shot of adjustable leaf feather ring with iridescent rainbow electroplating finish - Rainbow
Detail view of gold feather ring with 1.7cm adjustable inner diameter measurements - Gold
Vintage Stainless Steel Feather Open Ring Adjustable Leaf Texture Band Ring For Women Men Minimalist Fashion Jewelry Gift
$0.52-0.78
Mix MOQ : 2
Free Shipping
Vintage Hip Hop Star Embossed Stainless Steel Ring For Men Retro Distressed Punk Wide Band Finger Ring Jewelry Gift
Vintage Hip Hop Star Embossed Stainless Steel Ring For Men Retro Distressed Punk Wide Band Finger Ring Jewelry Gift
like
Find Similar
Vintage stainless steel wide band ring with embossed stars and distressed finish - US 7 / Antique Silver
+5
Vintage Hip Hop Star Embossed Stainless Steel Ring For Men Retro Distressed Punk Wide Band Finger Ring Jewelry Gift
$3.41
No MOQ
Free Shipping
Vintage Stainless Steel Ring With Rectangular Red Rhinestone Inlaid Wide Band Geometric Punk Jewelry For Men Women Daily Party
Vintage Stainless Steel Ring With Rectangular Red Rhinestone Inlaid Wide Band Geometric Punk Jewelry For Men Women Daily Party
like
Find Similar
Vintage stainless steel ring with a square-cut red gemstone on a polished band - US 7 / Steel
+6
Vintage Stainless Steel Ring With Rectangular Red Rhinestone Inlaid Wide Band Geometric Punk Jewelry For Men Women Daily Party
-4%
$3.24
No MOQ
Free Shipping
Stainless Steel Multi Layer Rhinestone Stackable Rings For Women Ins Style Gold Silver Plated Full Drill Geometric Finger Ring Jewelry
Stainless Steel Multi Layer Rhinestone Stackable Rings For Women Ins Style Gold Silver Plated Full Drill Geometric Finger Ring Jewelry
like
Find Similar
Detail of multi-layered gold ring featuring sparkling pavé crystals and sandblasted texture - US 6 / Frosted Rhinestone Multi-Layer Style (RC-1006G)
Detail view of multi-layer gold plated ring with crystal inlay and size measurement - US 6 / Multi-Link Pavé Style (RC-1007G)
Close-up of interlocking multi-layer gold and silver rings with size and weight measurements - US 6 / Gold and Silver Interlocking Style (RC-1010GS)
+6
Stainless Steel Multi Layer Rhinestone Stackable Rings For Women Ins Style Gold Silver Plated Full Drill Geometric Finger Ring Jewelry
$1.47-1.52
No MOQ
 · 
11 views
Free Shipping
Vintage Stainless Steel Floral Embossed Wide Ring For Men Antique Silver Gold Tone Flower Pattern Retro Finger Jewelry
Vintage Stainless Steel Floral Embossed Wide Ring For Men Antique Silver Gold Tone Flower Pattern Retro Finger Jewelry
like
Find Similar
Vintage stainless steel wide ring with embossed floral relief and gold bead detail - US 8 / Flower Embossed Antique Silver (XYR0016)
Vintage Stainless Steel Floral Embossed Wide Ring For Men Antique Silver Gold Tone Flower Pattern Retro Finger Jewelry
$3.14
Mix MOQ : 2
Free Shipping
Minimalist Band Ring Stainless Steel Ultra Thin Polished Plain Surface Stacking Finger Jewelry For Men Women Simple Comfort Fit
Minimalist Band Ring Stainless Steel Ultra Thin Polished Plain Surface Stacking Finger Jewelry For Men Women Simple Comfort Fit
like
Find Similar
2mm ultra-thin silver minimalist stackable stainless steel ring in sizes 6 to 11 - US 6 / Silver
Minimalist 2mm gold-toned stainless steel stacking ring in polished finish - US 6 / Gold
Minimalist 2mm black stainless steel ring with a brushed matte texture finish - US 6 / Black
2mm slim polished stainless steel ring in rose gold finish for women size 6-11 - US 6 / Rose Gold
+38
Minimalist Band Ring Stainless Steel Ultra Thin Polished Plain Surface Stacking Finger Jewelry For Men Women Simple Comfort Fit
$0.31-0.48
No MOQ
 · 
36 sold recently
Free Shipping
Minimalist Stainless Steel Freshwater Pearl Ring For Women Men Gold Silver Plated Linear Pearl Finger Ring Fashion Jewelry Gift
Minimalist Stainless Steel Freshwater Pearl Ring For Women Men Gold Silver Plated Linear Pearl Finger Ring Fashion Jewelry Gift
like
Find Similar
Minimalist 18K gold plated stainless steel ring with five natural freshwater pearls - US 8 (57mm) / Gold
Size chart for stainless steel rings with freshwater pearl details and silver finish - US 8 (57mm) / Steel
+8
Minimalist Stainless Steel Freshwater Pearl Ring For Women Men Gold Silver Plated Linear Pearl Finger Ring Fashion Jewelry Gift
-5%
$2.31-2.41
No MOQ
 · 
15 sold recently
Free Shipping
Vintage Titanium Steel Men Ring With Rectangular Black Gemstone Geometric Hollow Mesh Texture Individual Jewelry For Men Party Daily
Vintage Titanium Steel Men Ring With Rectangular Black Gemstone Geometric Hollow Mesh Texture Individual Jewelry For Men Party Daily
like
Find Similar
Men's retro stainless steel ring with rectangular black gemstone and hollow geometric side - US 7 / Silver
Vintage gold-plated stainless steel men's ring with rectangular black obsidian stone - US 7 / Gold
+10
Vintage Titanium Steel Men Ring With Rectangular Black Gemstone Geometric Hollow Mesh Texture Individual Jewelry For Men Party Daily
$3.93-4.19
No MOQ
Free Shipping
Articulated Armor Ring Alloy Dragon Skeleton Scorpion Movable Joint Punk Gothic Vintage Jewelry For Women And Men
Articulated Armor Ring Alloy Dragon Skeleton Scorpion Movable Joint Punk Gothic Vintage Jewelry For Women And Men
like
Find Similar
Retro dragon head joint ring in silver alloy with red rhinestone eyes on white background - Type A-Dragon Head Articulated Ring
Vintage silver dragon knuckle armor ring with red rhinestone eyes in punk style - Type C-Vintage Dragon Articulated Ring
Detail of silver scorpion armor ring featuring dual-ring structure and punk white crystal - Type E-Scorpion Articulated Ring
Vintage silver dragon knuckle ring with red rhinestone eyes and white pearl detail - Type B-Dragon with Pearl Articulated Ring
+2
Articulated Armor Ring Alloy Dragon Skeleton Scorpion Movable Joint Punk Gothic Vintage Jewelry For Women And Men
-4%
$0.72
Mix MOQ : 2
 · 
38 views
Vintage Stainless Steel Rotatable Spinner Ring With Cuban Chain Inlay Punk Rock Jewelry For Men Women Stress Relief Band
Vintage Stainless Steel Rotatable Spinner Ring With Cuban Chain Inlay Punk Rock Jewelry For Men Women Stress Relief Band
like
Find Similar
Polished stainless steel spinner ring with rotatable Cuban chain in punk rock style - US 7 / Steel
+6
Vintage Stainless Steel Rotatable Spinner Ring With Cuban Chain Inlay Punk Rock Jewelry For Men Women Stress Relief Band
$3.41
No MOQ
Free Shipping
Hip Hop Men Jesus Crucifix Cross Ring Stainless Steel Iced Out Rhinestone Gold Silver Plated Religious Fashion Ring
Hip Hop Men Jesus Crucifix Cross Ring Stainless Steel Iced Out Rhinestone Gold Silver Plated Religious Fashion Ring
like
Find Similar
Polished silver stainless steel men's Jesus cross ring with sparkling zircon stones - US 7 / Steel Color (US Size)
Gold-plated stainless steel Jesus cross ring with sparkling zircon stones for men - US 7 / Gold Color [US Size]
+12
Hip Hop Men Jesus Crucifix Cross Ring Stainless Steel Iced Out Rhinestone Gold Silver Plated Religious Fashion Ring
$2.88-3.14
No MOQ
Free Shipping
316L Stainless Steel Razor Blade Ring For Men Women Punk Gothic Hollow Out Sawtooth Band Ring Vintage Industrial Jewelry
316L Stainless Steel Razor Blade Ring For Men Women Punk Gothic Hollow Out Sawtooth Band Ring Vintage Industrial Jewelry
like
Find Similar
Gothic silver stainless steel ring featuring unique serrated blade edge design and mirror polish - US 7 / Steel
+6
316L Stainless Steel Razor Blade Ring For Men Women Punk Gothic Hollow Out Sawtooth Band Ring Vintage Industrial Jewelry
-5%
$3.43
No MOQ
Free Shipping
Retro Alloy Open Adjustable Rings Vintage Gothic Snake Dragon Feather Carved Ethnic Fashion Jewelry For Women Men
Retro Alloy Open Adjustable Rings Vintage Gothic Snake Dragon Feather Carved Ethnic Fashion Jewelry For Women Men
like
Find Similar
Vintage silver 3D cobra snake open ring with detailed scales and retro black finish - 3D Cobra Shape - Antique Silver
Vintage silver evil eye open ring with retro engraved cloud patterns for women - Cloud Pattern - Antique Silver
Retro silver adjustable ring featuring traditional cloud patterns and a vintage finish - Retro Cloud Engraving - Antique Silver
Retro silver feather open ring featuring a vibrant red gemstone and vintage metal textures - Feather with Red Gem - Antique Silver
+3
Retro Alloy Open Adjustable Rings Vintage Gothic Snake Dragon Feather Carved Ethnic Fashion Jewelry For Women Men
$0.31
No MOQ
 · 
33 sold recently
Vintage Stainless Steel Cuban Link Chain Ring For Men Women Antique Silver Distressed Woven Hollow Band Ring Punk Jewelry
Vintage Stainless Steel Cuban Link Chain Ring For Men Women Antique Silver Distressed Woven Hollow Band Ring Punk Jewelry
like
Find Similar
Cuban link chain ring in silver stainless steel with vintage oxidation on black reflection - US 7 / Thin Cuban Link (A款戒指)
Minimalist vintage Cuban link chain ring in oxidized stainless steel with shadow reflection - US 7 / Thick Cuban Link (B款戒指)
+10
NewVintage Stainless Steel Cuban Link Chain Ring For Men Women Antique Silver Distressed Woven Hollow Band Ring Punk Jewelry
-4%
$2.99
No MOQ
 · 
42 sold recently
Free Shipping
Rotatable Flower Anxiety Relief Ring For Women Copper Rhinestone Sunflower Butterfly Open Adjustable Rings Fashion Jewelry Gift
Rotatable Flower Anxiety Relief Ring For Women Copper Rhinestone Sunflower Butterfly Open Adjustable Rings Fashion Jewelry Gift
like
Find Similar
Adjustable silver rotating fidget ring with cubic zirconia moon and star design - Adjustable Open / White Gold Moon Star Open (AJ067)
Adjustable S925 sterling silver spinning flower ring with white cubic zirconia crystals - Adjustable Open / White Gold Rotating Flower (AJ061)
Silver adjustable rotating anxiety ring with sparkling butterfly crystal design - Adjustable Open / White Gold Butterfly (AJ065)
Golden butterfly spinner ring with clear zircon stones for anxiety relief and decompression - Adjustable Open / Gold Butterfly (AJ065)
+17
Rotatable Flower Anxiety Relief Ring For Women Copper Rhinestone Sunflower Butterfly Open Adjustable Rings Fashion Jewelry Gift
-5%
$1.69
No MOQ
 · 
261 sold recently
Free Shipping
Vintage Men Stainless Steel Square Rhinestone Dragon Relief Signet Ring Punk Rock Male Gemstone Band Jewelry Accessories
Vintage Men Stainless Steel Square Rhinestone Dragon Relief Signet Ring Punk Rock Male Gemstone Band Jewelry Accessories
like
Find Similar
Punk style titanium steel men's signet ring with large blue gemstone and relief carving - US 7 / Stainless Steel Silver Color Blue Zirconia
Men's silver steel ring featuring a black square gemstone and side dragon carvings - US 7 / Steel Color Black Zircon
Mens vintage stainless steel ring with dragon relief and square red gemstone inlay - US 7 / Steel Red Zircon
Men's punk stainless steel dragon ring featuring a large rectangular green gemstone center - US 7 / Silver With Green Zircon
+45
Vintage Men Stainless Steel Square Rhinestone Dragon Relief Signet Ring Punk Rock Male Gemstone Band Jewelry Accessories
-4%
$2.49
No MOQ
Free Shipping
Minimalist Stainless Steel Ring Thin Stackable Polished Band Plain Jewelry For Men And Women Unisex
Minimalist Stainless Steel Ring Thin Stackable Polished Band Plain Jewelry For Men And Women Unisex
like
Find Similar
Close-up of a 2mm silver titanium steel ring with a high-polished minimalist finish - US 5 / Silver
Detailed side view of 2mm black polished stainless steel minimalist band ring - US 5 / Black
Detail view of a 2mm minimalist electric blue titanium steel ring with polished finish - US 5 / Blue
Macro detail of 2mm rainbow titanium steel ring showing smooth polished finish and metallic luster - US 5 / Colorful
+62
Minimalist Stainless Steel Ring Thin Stackable Polished Band Plain Jewelry For Men And Women Unisex
$0.10-0.47
No MOQ
 · 
72 sold recently
Free Shipping
Faceted Ceramic Ring Geometric Rhombic Cut Modern Minimalist Fashion Band For Men Women Couples Unisex Jewelry
Faceted Ceramic Ring Geometric Rhombic Cut Modern Minimalist Fashion Band For Men Women Couples Unisex Jewelry
like
Find Similar
Elegant white ceramic ring featuring a geometric diamond-cut textured faceted surface - US 5 / White
Polished black faceted ceramic ring with geometric diamond cut surface and comfort fit inner band - US 5 / Black
+14
Faceted Ceramic Ring Geometric Rhombic Cut Modern Minimalist Fashion Band For Men Women Couples Unisex Jewelry
$2.10
No MOQ
 · 
188 sold recently
Free Shipping
Double Layer Crown Ring Set Alloy Silver Plated Rhinestone Wedding Bridal Engagement Finger Rings For Women Fashion Jewelry
Double Layer Crown Ring Set Alloy Silver Plated Rhinestone Wedding Bridal Engagement Finger Rings For Women Fashion Jewelry
like
Find Similar
5 options
Double Layer Crown Ring Set Alloy Silver Plated Rhinestone Wedding Bridal Engagement Finger Rings For Women Fashion Jewelry
$0.96
Mix MOQ : 2
 · 
17 sold recently
Urban Chic Stainless Steel 3D Butterfly Open Ring For Women Adjustable Gold Finger Ring Elegant Fashion Jewelry Gift
Urban Chic Stainless Steel 3D Butterfly Open Ring For Women Adjustable Gold Finger Ring Elegant Fashion Jewelry Gift
like
Find Similar
Detailed view of golden 3D butterfly ring showing dimensions of 1.77cm and 4g weight - Butterfly Open Style (RC-939G) / Gold
Urban Chic Stainless Steel 3D Butterfly Open Ring For Women Adjustable Gold Finger Ring Elegant Fashion Jewelry Gift
$2.04
No MOQ
Free Shipping
Vintage Stainless Steel Ganesha Elephant God Ring For Men Retro Oxidized Relief Religious Jewelry Band Ring Gift Accessory
Vintage Stainless Steel Ganesha Elephant God Ring For Men Retro Oxidized Relief Religious Jewelry Band Ring Gift Accessory
like
Find Similar
Vintage stainless steel elephant god Ganesha ring with oxidized silver finish for men - US 7 / Silver
+5
NewVintage Stainless Steel Ganesha Elephant God Ring For Men Retro Oxidized Relief Religious Jewelry Band Ring Gift Accessory
$3.41
No MOQ
Free Shipping
Minimalist Stainless Steel Band Ring Waterproof Non-Fading Geometric Enamel Inlay Fashion Jewelry For Men Women
Minimalist Stainless Steel Band Ring Waterproof Non-Fading Geometric Enamel Inlay Fashion Jewelry For Men Women
like
Find Similar
Minimalist gold-plated stainless steel ring featuring polished black enamel inlay - US 5 / Gold Black
Minimalist wide band ring in rose gold finish with smooth white ceramic inlay - US 7 / Rose Gold White Enamel
Detail of minimalist stainless steel ring with two-tone rose gold and black inlay finish - US 7 / Rose Gold Black Enamel
Polished silver stainless steel band ring with black enamel inlay in a modern style - US 7 / Steel Black Enamel
+41
Minimalist Stainless Steel Band Ring Waterproof Non-Fading Geometric Enamel Inlay Fashion Jewelry For Men Women
$0.18-0.26
No MOQ
 · 
70 sold recently
Minimalist Band Ring Titanium Stainless Steel Brushed Center Groove Fashion Simple Jewelry For Men Women
Minimalist Band Ring Titanium Stainless Steel Brushed Center Groove Fashion Simple Jewelry For Men Women
like
Find Similar
Polished gold titanium steel ring with brushed finish surface and decorative center groove - US 6 / Gold
Minimalist titanium steel ring for men with brushed finish and polished silver edges - US 6 / Silver
Men's black titanium steel ring with brushed center and polished edges at a 45-degree angle - US 6 / Black
+21
Minimalist Band Ring Titanium Stainless Steel Brushed Center Groove Fashion Simple Jewelry For Men Women
$0.21-0.28
No MOQ
 · 
668 sold recently
French Style Stainless Steel Large Oval Dome Ring For Women High Polish Gold Silver Beaded Edge Statement Finger Ring Jewelry
French Style Stainless Steel Large Oval Dome Ring For Women High Polish Gold Silver Beaded Edge Statement Finger Ring Jewelry
like
Find Similar
French luxury oval cocktail ring in polished stainless steel with elegant beaded border detail - Size 6 / Steel
Elegant gold oval mirror ring with bead edge detailing in polished stainless steel - Size 6 / Gold
+10
French Style Stainless Steel Large Oval Dome Ring For Women High Polish Gold Silver Beaded Edge Statement Finger Ring Jewelry
$2.88-3.41
No MOQ
Free Shipping
Vintage Stainless Steel Celtic Knot Ring For Men Women Square Colorful Rhinestone Inlaid Retro Punk Party Finger Ring Fashion Jewelry
Vintage Stainless Steel Celtic Knot Ring For Men Women Square Colorful Rhinestone Inlaid Retro Punk Party Finger Ring Fashion Jewelry
like
Find Similar
Vintage stainless steel ring with square ruby stone and Celtic knot relief patterns - US 7 / Silver Red
Vintage men's titanium steel ring with emerald green crystal and ornate floral engraving - US 7 / Silver Green
Vintage stainless steel ring featuring engraved vine patterns and a blue gemstone - US 7 / Silver Blue
Retro men's titanium steel ring featuring a square black gemstone and ornate vintage carving - US 7 / Steel Color Black Gemstone
+20
Vintage Stainless Steel Celtic Knot Ring For Men Women Square Colorful Rhinestone Inlaid Retro Punk Party Finger Ring Fashion Jewelry
$3.93
No MOQ
Free Shipping
Vintage Skull Ring For Men Gothic Punk Stainless Steel Band Polished Full Skull Pattern Jewelry Finger Ring Gift
Vintage Skull Ring For Men Gothic Punk Stainless Steel Band Polished Full Skull Pattern Jewelry Finger Ring Gift
like
Find Similar
Macro shot of silver stainless steel skull ring with vintage gothic skeleton carvings - US 7 / Steel
+5
Vintage Skull Ring For Men Gothic Punk Stainless Steel Band Polished Full Skull Pattern Jewelry Finger Ring Gift
$2.88
No MOQ
 · 
14 sold recently
Free Shipping
Stainless Steel Luminous Religious Ring Glow In Dark Titanium Band Jesus Fish Christian Jewelry For Men Women Vintage Gift
Stainless Steel Luminous Religious Ring Glow In Dark Titanium Band Jesus Fish Christian Jewelry For Men Women Vintage Gift
like
Find Similar
Detailed macro view of silver stainless steel ring with Jesus Ichthys rose gold fish - US 6 / Gold
Detailed macro view of Jesus and Ichthys fish engraving on polished steel ring band - US 6 / Silver
+14
Stainless Steel Luminous Religious Ring Glow In Dark Titanium Band Jesus Fish Christian Jewelry For Men Women Vintage Gift
$0.68
No MOQ
925 Sterling Silver Minimalist Hollow Out Heart Open Ring For Women Adjustable Dainty Finger Ring Fashion Jewelry Gift
925 Sterling Silver Minimalist Hollow Out Heart Open Ring For Women Adjustable Dainty Finger Ring Fashion Jewelry Gift
like
Find Similar
2 options
925 Sterling Silver Minimalist Hollow Out Heart Open Ring For Women Adjustable Dainty Finger Ring Fashion Jewelry Gift
$17.03
No MOQ
Free Shipping
Retro Punk Gothic Alloy Rings For Men Women Vintage Adjustable Open Design Snake Dragon Skull Octopus Hip Hop Jewelry
Retro Punk Gothic Alloy Rings For Men Women Vintage Adjustable Open Design Snake Dragon Skull Octopus Hip Hop Jewelry
like
Find Similar
Vintage punk silver alloy snake ring with detailed scales and adjustable open design - Double Snakes
Vintage punk chain link open ring for men with antique silver finish and adjustable design - Hollow Out Ring
Vintage silver punk crying face open ring with adjustable band and matte finish - Crying Face
Detailed view of vintage silver adjustable ring featuring intricate feather textures - Wing
+12
Retro Punk Gothic Alloy Rings For Men Women Vintage Adjustable Open Design Snake Dragon Skull Octopus Hip Hop Jewelry
-4%
$0.50-0.70
No MOQ
 · 
85 sold recently
Vintage Chinese Style Monkey King Golden Cudgel Open Ring Titanium Steel Cloud Pattern Adjustable Ring For Men Women
Vintage Chinese Style Monkey King Golden Cudgel Open Ring Titanium Steel Cloud Pattern Adjustable Ring For Men Women
like
Find Similar
Retro Monkey King staff ring with traditional cloud pattern on black mirror base - US 7 / Steel
Retro golden Monkey King bar ring with traditional auspicious cloud pattern and reflection - US 7 / Gold
+10
Vintage Chinese Style Monkey King Golden Cudgel Open Ring Titanium Steel Cloud Pattern Adjustable Ring For Men Women
-5%
$3.24-3.48
No MOQ
Free Shipping
Stainless Steel Luminous Ring Vintage Celtic Dragon Pattern Fluorescent Glow In The Dark Band Ring For Men Women Gothic Punk Jewelry
Stainless Steel Luminous Ring Vintage Celtic Dragon Pattern Fluorescent Glow In The Dark Band Ring For Men Women Gothic Punk Jewelry
like
Find Similar
Close-up of black stainless steel ring with blue Celtic dragon pattern on white background - US 7 / Luminous Black Dragon
Detail of black stainless steel ring with blue carbon fiber inlay and silver dragon pattern - US 7 / Luminous Silver Dragon
Macro detail of black stainless steel ring with blue inlay and golden dragon pattern - US 7 / Luminous Gold Dragon
+21
Stainless Steel Luminous Ring Vintage Celtic Dragon Pattern Fluorescent Glow In The Dark Band Ring For Men Women Gothic Punk Jewelry
-3%
$0.50
Mix MOQ : 2
 · 
1 reviews
Men Retro Adjustable Dragon Ring Alloy Electroplated Punk Gothic Silver Carved Dragon Animal Open Finger Ring Fashion Jewelry Gift
Men Retro Adjustable Dragon Ring Alloy Electroplated Punk Gothic Silver Carved Dragon Animal Open Finger Ring Fashion Jewelry Gift
like
Find Similar
Adjustable dragon-shaped ring in vintage silver finish with detailed scale embossing - Adjustable / Silver
Men Retro Adjustable Dragon Ring Alloy Electroplated Punk Gothic Silver Carved Dragon Animal Open Finger Ring Fashion Jewelry Gift
$0.73
Mix MOQ : 2
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
like
Find Similar
Detailed macro view of a gold-plated stainless steel square link bracelet with crystals - Square Link Bracelet (39-E-9) / Gold
Detailed view of a rose gold stainless steel bracelet with crystal-set square links. - Square Link Bracelet (39-E-10) / Rose Gold
Macro detail of polished stainless steel square link bracelet with small inlaid stones - Square Link Bracelet (39-E-8) / Steel
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
$1.96-2.25
No MOQ
 · 
384 sold recently
Minimalist Punk Titanium Steel Ring Silver Color Black Enamel Rectangle Inlay Retro Industrial Band Jewelry For Men Women
Minimalist Punk Titanium Steel Ring Silver Color Black Enamel Rectangle Inlay Retro Industrial Band Jewelry For Men Women
like
Find Similar
Punk style stainless steel ring with black enamel inlay in a minimalist silver finish - US 7 / Silver
+5
Minimalist Punk Titanium Steel Ring Silver Color Black Enamel Rectangle Inlay Retro Industrial Band Jewelry For Men Women
$3.93
No MOQ
Free Shipping
Vintage Titanium Steel Ring For Men Gold Plated Overbearing Jewelry With Pixiu Relief Large Rectangle Zirconia Inlaid Ring
Vintage Titanium Steel Ring For Men Gold Plated Overbearing Jewelry With Pixiu Relief Large Rectangle Zirconia Inlaid Ring
like
Find Similar
Men's gold-plated dragon ring with rectangle red gemstone and Pixiu side relief - US 7 / Gold Red
Men's vintage gold-plated titanium steel ring with blue gemstone and dragon relief - US 7 / Gold Blue
Men's gold vintage dragon ring with green square gemstone and guardian beast engraving - US 7 / Gold Green
Men's gold plated ring featuring a black rectangular gemstone and dragon carving - US 7 / Gold Black
+20
Vintage Titanium Steel Ring For Men Gold Plated Overbearing Jewelry With Pixiu Relief Large Rectangle Zirconia Inlaid Ring
-4%
$2.99
No MOQ
Free Shipping
Minimalist Stainless Steel Triple Layer Hollow Ring For Men Women Fashion Geometric Polished Jewelry Unisex Band Ring Accessory
Minimalist Stainless Steel Triple Layer Hollow Ring For Men Women Fashion Geometric Polished Jewelry Unisex Band Ring Accessory
like
Find Similar
Three-layer silver stainless steel ring with minimalist hollow design on wood background - US 7 / Silver
+5
Minimalist Stainless Steel Triple Layer Hollow Ring For Men Women Fashion Geometric Polished Jewelry Unisex Band Ring Accessory
$3.67
No MOQ
Free Shipping
Vintage Stainless Steel Signet Ring For Men Square Black Blue Gemstone Punk Mesh Texture Band Ring Fashion Jewelry Gift
Vintage Stainless Steel Signet Ring For Men Square Black Blue Gemstone Punk Mesh Texture Band Ring Fashion Jewelry Gift
like
Find Similar
Vintage stainless steel ring for men with a square black stone and gold finish - US 7 / Vintage Gold Black Stone
Vintage silver signet ring for men featuring a square black stone and textured metal band - US 7 / Vintage Silver Black Stone
Vintage silver-tone stainless steel ring with rectangular blue lapis lazuli stone - US 7 / Silver Blue Stone
Men's vintage stainless steel signet ring with black stone on natural wood bark - US 7 / Silver Black Stone
+32
Vintage Stainless Steel Signet Ring For Men Square Black Blue Gemstone Punk Mesh Texture Band Ring Fashion Jewelry Gift
$4.19
No MOQ
Free Shipping
Smart NFC Stainless Steel Ring Technology Style Digital Circuit Board Pattern Geometric Finger Ring For Men Women Tech Jewelry
Smart NFC Stainless Steel Ring Technology Style Digital Circuit Board Pattern Geometric Finger Ring For Men Women Tech Jewelry
like
Find Similar
Blue metal NFC smart ring featuring electronic circuit board texture and sleek finish - US 6 / Blue
Detail of the polished stainless steel NFC smart ring with circuit board pattern and engraving - US 6 / Silver
+14
Smart NFC Stainless Steel Ring Technology Style Digital Circuit Board Pattern Geometric Finger Ring For Men Women Tech Jewelry
-4%
$2.49
No MOQ
Free Shipping
Vintage Stainless Steel Cross Couple Rings Hollow Out Design For Men Women Black Silver Polished Brushed Wedding Jewelry Finger Ring
Vintage Stainless Steel Cross Couple Rings Hollow Out Design For Men Women Black Silver Polished Brushed Wedding Jewelry Finger Ring
like
Find Similar
Polished silver titanium steel ring with minimalist hollow cross design for couples - 5# / Steel Color Female Style
Minimalist black stainless steel ring featuring a 3D hollow cross design for couples - 5# / Black Women's Style
Brushed stainless steel ring with a hollowed-out cross design in silver finish - Size 7 / Steel Color Male Style
Brushed black stainless steel ring featuring a cutout cross design for men and women - Size 7 / Black Men's Style
+20
Vintage Stainless Steel Cross Couple Rings Hollow Out Design For Men Women Black Silver Polished Brushed Wedding Jewelry Finger Ring
$1.18-1.96
No MOQ
 · 
52 sold recently
Free Shipping
Titanium Steel Spinner Ring For Men Women Chinese Dragon Pattern Blue Carbon Fiber Inlay Stress Relief Rotating Band Ring Jewelry
Titanium Steel Spinner Ring For Men Women Chinese Dragon Pattern Blue Carbon Fiber Inlay Stress Relief Rotating Band Ring Jewelry
like
Find Similar
Detail of rotating ring with blue carbon fiber and silver dragon pattern engraving - US 6 / Silver Base Blue Background Silver Dragon
Close-up of titanium spinner ring featuring blue carbon fiber and golden dragon inlay - US 6 / Silver Base Blue Background Gold Dragon
+14
Titanium Steel Spinner Ring For Men Women Chinese Dragon Pattern Blue Carbon Fiber Inlay Stress Relief Rotating Band Ring Jewelry
-4%
$1.00
No MOQ
Free Shipping
Titanium Stainless Steel Band Ring Frosted Sandblasted Polished Center Groove Fashion Jewelry For Men Couples
Titanium Stainless Steel Band Ring Frosted Sandblasted Polished Center Groove Fashion Jewelry For Men Couples
like
Find Similar
Detail showing 8mm golden titanium steel ring with polished and frosted dual textures - Gold / US 6
Detail view of 8mm men's silver matte titanium steel ring with double waistline design - Silver / US 6
Detailed view of 8mm black titanium ring with frosted surface and polished inner groove - Black / US 6
+21
Titanium Stainless Steel Band Ring Frosted Sandblasted Polished Center Groove Fashion Jewelry For Men Couples
-5%
$0.32-0.40
No MOQ
 · 
428 sold recently
Free Shipping
Vintage Stainless Steel Skull With Top Hat Ring For Men Gothic Punk Distressed Skeleton Finger Ring Biker Jewelry Accessories
Vintage Stainless Steel Skull With Top Hat Ring For Men Gothic Punk Distressed Skeleton Finger Ring Biker Jewelry Accessories
like
Find Similar
6 options
Vintage Stainless Steel Skull With Top Hat Ring For Men Gothic Punk Distressed Skeleton Finger Ring Biker Jewelry Accessories
-4%
$2.74
No MOQ
 · 
12 sold recently
Free Shipping
Checkerboard Stainless Steel Titanium Ring Unisex 18K Gold Plated Minimalist Chic Finger Ring Enamel Drip Glaze Jewelry Gift
Checkerboard Stainless Steel Titanium Ring Unisex 18K Gold Plated Minimalist Chic Finger Ring Enamel Drip Glaze Jewelry Gift
like
Find Similar
Classic checkered black and white titanium steel ring with minimalist silver finish - US 6 / Silver
Classic 18K gold plated titanium steel ring with black and white checkered enamel design - US 6 / Gold
+14
Checkerboard Stainless Steel Titanium Ring Unisex 18K Gold Plated Minimalist Chic Finger Ring Enamel Drip Glaze Jewelry Gift
$2.36-2.62
No MOQ
 · 
80 sold recently
Free Shipping
Minimalist Stainless Steel Chain Ring For Women Gold Plated IP Gold Plating Cuban Link Hollow Geometric Fashion Jewelry
Minimalist Stainless Steel Chain Ring For Women Gold Plated IP Gold Plating Cuban Link Hollow Geometric Fashion Jewelry
like
Find Similar
4 options
Minimalist Stainless Steel Chain Ring For Women Gold Plated IP Gold Plating Cuban Link Hollow Geometric Fashion Jewelry
$3.51
Mix MOQ : 2
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access